Transaction
acda713bb52dd7c43e73a52104835984b234c6f752b5d572d57ffb11c533d2f2


Summary


Timestamp
6/30, 2020 05:45utc(1y, 6mo, 18d ago)
Version
1
Size
8,074B
Confirmations
80,776
Fee Paid
81.05XEC
Fee Rate
(1,004,000sat/B)
Days Destroyed
1,934,508xd

46 Inputs/46 Outputs
















































Total Input: 6,431,715.17XEC
OP_RETURN
data(utf-8) - Y qu=�r6v�\<��� �?Xڏp r����
show raw
0

Total Output: 6,431,634.12XEC

Input Scripts


Script Sig (asm)
>#019c3e1ea9ed7e4f8d760082da1c2d83d03ad16cb60dac333a3e7c5f561a1276a83822d5ebea8cd31bedce7818b2f8845df82d080884aa2c0e2ecbf8b4d2e9c33[ALL|FORKID] 02105792f01a0493cd19698509ba57be9e15881af9957102c1c06b6a582abe8c79
>#10013f00452453341f3911299002fc8362915cb8df3fed4279942685d2fb0cf9606e3e1aa5000c285de7f824844fa58ca9d746308701533d3eecbab4f53b6b137[ALL|FORKID] 03a6a4f9bf118a74990dc56ff214a23244abcd7215f162260a07e116f36465f868
>#2e986a00851238d48c6ecaebdcaddfafffe088f075259012117c272bb73e64cd01e9a707ffcb017d468edcebc265f9f3978195a5cd5cbe5ede38e3ce0cfcf409e[ALL|FORKID] 032e0c9bf69404e033e171e75d850176b3256348a0c9a9e45cf286962bd43d48ae
>#3838d0591451879a008f5c70970d600504251173681e09bc1012400cd3a4496a550f22cf5d60fc49be921efd27851a37bac6d2ecc2e8c7826108bf94673c769b8[ALL|FORKID] 02c72fbb98ef796270d44a971f15efeab25369e22c77b72ca5dd9fb1e0ad4f04f4
>#461ecddaee7ae9e9e8ae9a5e0536ddf5cb3dd68b0244dd9effd353eeb8afcd41d7217ff49ac96c80c1e09c3fa05e7d8c5c98f210ab2c8f3c339b7a7000c64f2ca[ALL|FORKID] 03750674c62f32f6e15587d48c3b86ea18ce07abb477dcbf01adf1090548fc8c99
>#52db03e2bc220a2c120ddd699887d5a4e7eabb31141271dca9e5548a3ca10656ad15b582a6f49c9fea37fdc973920868fb25357bfff8826a606e23a57d165185b[ALL|FORKID] 0255be8270cd432b9419db34577ed1ce5841f229c41148f3457b3095f7bd33f095
>#69f949837d3c6334d11d9c446c3daa5e2101a416aca93d35a602894d553ba0d61d90bfc4cad764e2369d9c25cd41a352ebe36bb7e9dd5a29ade784c58e88a3482[ALL|FORKID] 03168a81409d3eb5851f30cd3f01da1cfb3779a239d3b2d20e99029a38d4e20094
>#75d84e68a797b70b602c914af24f3baaa4edb6cf0aceedbdb7b0ee5a0c9a30217695147749c342afb4088519a19a34e36bfd101cb4e5f0bf980f9db5aeb1fae38[ALL|FORKID] 0386caf234ef321cd0e8f338115cf48681f8acd02bc44699744ba0143574c3a479
>#8c69af4483857bbf1edad0af60f60d7efd6f5bdfa50f242022dae2bfdc5a620590e8e436b12ed96c8025c48c3744b1a621f5aa9265864e5eb9a5ecaec742cdcc3[ALL|FORKID] 030a0cb5603fed0ef228876f13090e88b9b1e2847e7dccfd4dd52ac14870f59834
>#992ae497fdbc60112ca96790856214ea7a69dfe6825f3f5f990f92060acf367ee9cb59eed93b8249ebfd2161d1fa4fc2ad19d5e5fa2589198a73833dfed9bcb93[ALL|FORKID] 0247acdbfdda61241f4451729e8f04465657273f80a1919e58474d5e5b9c356e76
>#10e389da2b9ecbe9044dbb6872a72492a919681e4eb1898b30e87d432ad2606398e0de06c4638578678acb4815847c1e966a8486125f0b6ecd738b92cd1dadb1fe[ALL|FORKID] 03b59be878fd25b40719d79290fbf916edb2c1c1b16156a43dbd5f577687053fac
>#1153fa14581c6c5f26289efc2e3532bcf1114287bb8965655ffd283b6f88c22fad8fe2ee2a343c3596dd8309862f853198f6dd4326558a0d9fa81287fb3dc586e3[ALL|FORKID] 03cac0e28f52bd194c73004b2ba298638a6aa374c88fe1a25afe7921410c811967
>#12e2e27648342f377307c64b6aafa399ff6254e78afccbadda4acb5c93c56b64a3a4326241305c688385bc4ead7e56432f220f7a741e95318439333ac247d34e7e[ALL|FORKID] 0237f26bc7d47d64eaae12adf28385440c71846933bdf6d2f2eea778521ba68531
>#131f127bf5c1621c847f1035c7ab0b974fb012a53a4d74af2ebf234b9dca8d0627314bd1380a23f988a1eb924b7e8d835b18010d66d4879066ec86fdf0ac464335[ALL|FORKID] 030aacbacf8a4e54e50c15e90fd9fa70bbbd5125de094fc8971cf45ea1f7c8080e
>#14b515c4c29a05cfb202beb1d7cdf46afa5b83e16b68210a418edb8dc9b78a6668da02361e6086d2f247855cbed7fe5675409dad2bdfe892a5636b16b6194c47ea[ALL|FORKID] 0281f102a57397b784c3df2c12c282bafa09a771bcb9fa0c97d5eddf3d80bdc8ab
>#15bcdb38f9b1363ece1b6471807b1b5bb379b0515afdd1fdc05a91b02145811cf88b6045a377eaff1d4a0a4b78c17922795beebb8bd9f76e8a958a677fd5d562ba[ALL|FORKID] 030dcc81b66e218c3455bb21f6861dc861e577f1603830d97d72d34e72b9ac6968
>#166f683ef158e38c701934638eda0728be44c4e6ce2e27f446bbc8b7ca2a790a9dbb4bacd08209de0db1f77f2c2b80f7309bcb8537285e7b1501339384fdb9a266[ALL|FORKID] 03f3fa4089d439011523fc2d566d13f1b523e53ecc30599d7a6c649fd082ae8f79
>#170c4406667f99a3a24e094d036babd4dcf27a4988b906b4952b364816e246d6495a0f6dafbd94fe2efcd3a4433c941b4e3e862637a39875b596fa7a488c7a2143[ALL|FORKID] 02ef7adb0b4a83a5f8325505e61f17eb7e4d71bdd777f1e131cec421e6ca65b22f
>#18e6c6d783b5073c0742ff54132c5b1b0766e1d23a5322ef1bf1f6ce464c4c8a6bcdf6876e86c4a412518119a1381eb6622f3f273be7a9274b3b75ade89c1ddc02[ALL|FORKID] 03ad0ab9ef0608bc3a7a425875700e1ef5141e293ab3c62a9f38520936dddafc12
>#1985740696857ec49e6cfdb0356ae4347c6c45c2ff2e7c7c54a95393b208d2da83a4dbe69b9a12eef9aa53afc1db223ca3b2a49490b0f4031537a00e225cabdd3e[ALL|FORKID] 02c28801a5f2e231087dba3aedab1d6c440e0f98c3fa38ca4a00c0100c62ddc0ff
>#206c2f5320111a1122efc643dfb2f6342d44334cd4bfe24afcde10cdfa72077f00bca0e894d7bdd317900aa0a43603227856e0d5f99b7cfe99c109407f7d665650[ALL|FORKID] 036fd2304b7eabb4675ad63ee6f3fa81c87f8faf37bf18dc2906f47333a4a03dab
>#211db90a12d709a501212172caf671539c12ab88935ba851cfabc81e5cef9aab15b9b31234b2853ac545df4bd5d55499e77c108b302bc850b67d5eb952d4b02cc0[ALL|FORKID] 0394e2d7151be508e3ae3735e42be829645d76585756b75f54fbd1a8a8e8dc835d
>#2250343bf802315b3d83adef4031313fb3e5379bbefa9ff2c36b983918e2c09841f4c04e234a597dc838847d9c488676a8a46c0eda9e369524c171be8381d711ca[ALL|FORKID] 021eead4e66e4601c68ccda0ddddddf464d695e115861ce9679779f6cbc6f11388
>#23684b57cbba0f68036262d1ac065c5992bad5abf6072e4297b1a7765f693bb4ebea1eaa8eefeefc1114b4206e155fe3792d3b2e88a1535a7d682eefdd4ae262af[ALL|FORKID] 024809c959c890757968daee0e5a01ea357defdf8219eab90fc2ca51eee8178380
>#24c684f9554dede4ada5004659b90df87a0f9bf3f254c329efb2bc7f2ffdf25b042821d476baa3b1d5f558b5eb04c0ececc59d51bd4b5fef30f9e7ed5550ca8472[ALL|FORKID] 032043dad8f4aa7eb5e87b42d662549e7a985f945e566ed7d06da58a790e2ed968
>#2595ef6f13a456aeb1d09c3a4f25334619dbfa721eea43fd541fff13197c1f21df6cf6e798b8448f6dd96c8cbff601ec1d6745a31cf1ab3b24ba720fe0bc32d9ce[ALL|FORKID] 02b4bc1b339abaa6575e5dcd58a24be28d75d9d9b9ee89db46b363ae99d62ac8a6
>#26463c5d017801dab770d63a42ac138524513903a5240c0668ed63b806927657d522101dba912c9e364623eeaf8e8a868b4c495b9eb1d263d7ff444b90864bd7c9[ALL|FORKID] 03eb30c0cdf651a033a647e86dbad331be7320eef8aa2da0c908fa1983ced8c6e2
>#2712209ca22b888a4e6da118031578c4623ec88d7e94cc5e3d87c3f5613b524606760ba3a6b9e79450b519072a4a4e90bae94b48d58c4c693ae0097d9508130018[ALL|FORKID] 03311a9459a479923e51e4e2774405a2af01a1793bb663f2864cbf8233ee97eeec
>#285e562d61d13a70c288c07de9e05554c183ef5be99b26fc13e6afcf86def6290cdcad7590aaef3efdd018a558420257e0e889867a10de4589559e3ba8ad7b91c0[ALL|FORKID] 02173612cd9fd086509df83a4f888b700aa058756d9cc8c74993c901b4adbc675f
>#29836f7ff51456eb33a265f4e588909ab2143c99ef9ca5133131783571bc7008d73db97f947d294f60d68a8d1ad8e59c5cb27895d5de5ae982dcdf151e8635191e[ALL|FORKID] 03f3142df0e6a05a2db0991e65ea017079cfb0382a9394ed5fc11568c98bc67066
>#3075e62e31a83fdde2cfa04c5ec14ce73209939f6b683ebbab24713f9391b279960b511d0be24f7f59dba5eb6f1f28331175419bd0836f180eec8c39e3ed60ccc8[ALL|FORKID] 02f2de07ea4d810f26e44f9916527c2e2d6788672cf7fb6e8e7db713752e53923b
>#319459e9caa64eed155109b86bd6fa7c681d056647e2b3a611a1d1104486643a237cd4b833ba92eba9135080107271fdaf1a03accee1f049378ccea91109a5565f[ALL|FORKID] 03dd4e1933febabf22b085dea3d5ae87f9c68a50282ab03b893e7b2d3e48117783
>#323feed27a60e6790b0b950b1e20839f87ccf21af644074c7548d7490238963d4606fa588802f280d1a0ee1e665f74454810fa04a758e0adb4ad2566d0376b48df[ALL|FORKID] 03d30e63a51dd5b0fafd6ec8025189c3cf47e35b08f47e64011e5c6d3c5df9d559
>#3364be71292ddfd6e9746dc08850766e91bb1cb5cef0ca0ea4db1478035a94ca84b7ad3a7a104a73560cb8a9f386d0dc9e19fe0fbecc272d96020707b01851aa44[ALL|FORKID] 020b98a876ce418d27208fd0693e3855fd583574ec719cc93248137b4af26fdbcd
>#34fb5fb146938897a3d52e8a3042e1d198c4d9f8a7ecbdf38b5c0e152bb94558e024bb5493313cf66aba70231323cb83de9312cbac78dc76aa26eb5425296233c3[ALL|FORKID] 02034616155fcd1e1bed39b790a75bd3257435511d047276008c9f6dc1923c7a69
>#3569ea493fb3a8a152a9dc40b0b12975f7b4ec1599238c8c6a448be5da23eceb8f6e8f813d126b2a0ac9b0c4d8e42b137222ff95907d68381a8d6e1eb737da2cde[ALL|FORKID] 032ec5bc4dc5b2fe7255f36fef71bd922b1812084119fbd9c52a92756fc3e9ec4e
>#369c3a911e18e32b2e1613b9e3dea692025827a5d9f48a4b02d6c04ae419e78bc2c530f11d9180f8510a2ff1c33a8616d860d30eb05587469db3bbbc4612b829de[ALL|FORKID] 031f6d95094c335fdcf558fd92a27c95d498f0f5e4752b48b1207b36f7dffc44bc
>#375b1a732d13ad47469ddc736365c9626df6d3172310e5b0f615e7c9b49aa1a557b8420969debb1eac48430be280c3554bc3465a6836b5ac07e13c7f8200e1764e[ALL|FORKID] 022909c62b2800fbf38bbba317d69595ca43d178592c5e066fdd6ad46d390128fb
>#38af68ac31028479b21f5ae91fa3d22d094c86baadc3fffc2f0968c12ad5e72b881934d12f395c6dc5819cd7a3c8d987228602ea42f9810f540b40a7dd4a53af67[ALL|FORKID] 02561b36b5462c0d7ba632f777ae0aacb29d3a5e6bdc6120d9431f18e66f3f587d
>#39ef7d89adabf992582e3cedac30fe3cbc8de46e7e54958dc5411b211f2bab41db55808c8097e5187c3f4b0fe06d7a4c56978b7d934c0dc5deeba99bc56db76f3a[ALL|FORKID] 036f32cfef910220b4fa0d5378065a4f8d57715cbfbef8acd36422e40d992dc03b
>#40c21e72b9f34bc18e849c2660c0b130f71270c1fffa017556e45fc8dd5ad02bb1fded528ec7c4c6bdfc351089a984cfeb6a43ceead5c0b6e28d5a3f9ea21d547e[ALL|FORKID] 0304884cdaa6ca2375866f65402b397984f88583025042cd4c57f870595c421d18
>#41b72bc232aecab332c45667d5663ef37f86025a074461687b135e3ec272c41d3539cf4228f89794a937e5a12cd32bcff08251d3a55401fa9ac6921a41f20a116c[ALL|FORKID] 03946e8a3b71b6886df066589596ab6cfb8f5995c2a635b88ecce52211c139ab84
>#427ca2ba78e7dc92ed39a42ebfaf49a6455c07c8c8a2364bbfdddb7a5cf99ae35bd5fab4acc3abc8a2fdd6b4d23896f855cdc85b464ae85f4688b357b251e1517d[ALL|FORKID] 021056618df94fbe9c9a327758ffe35fbf3684ae9d5b5c47f61592d07fce8c0dd6
>#43e73f3d61b99d45a9429be0bdbbcb2bda77384c6feb37a6a3de0329a7cc03cccbed08930769f6ed51ed68f52ac2ef9ed10409b267425d797f40afcf699effd48e[ALL|FORKID] 03bfe0cbc3b88241f098c4824c995873f0b9ad25099f16de9286dafb3533faea88
>#440c9af0e0795b433b8ae41ed9aa386a95ef7600b73c7a86c86036bc6c19bed600c8ade6533e81fc4f0720c117225c49497518b346475b8d980f1492937eff73ca[ALL|FORKID] 0293a07ccb936c98578d5149fc611d688d6baecac80c44b4677411a852572fd160
>#45225c89cdd51b25e58574d6270ab2a6d350dfd3a81adecb4bcb26ac1359dd1246ab018ecffe63c18605d8abde2ac85d29c5b6efb0586a9118f179772fcb9078cd[ALL|FORKID] 038b7b11d0adbe61248760d4732cd6b3e839c5a3b2fd5f9d5d2fe55ec799708df9

Output Scripts


Script Pub Key (asm)
, #0OP_RETURN 5920070 71753da172361476d45c003cd70e85d609f33f5806da8f7020721db1b3cf10a5
(decoded) Y qu=�r6v�\<��� �?Xڏp r����
, #1OP_DUP OP_HASH160 3d7aef3251348e748a2cc717b7c7fc0ff03fabd7 OP_EQUALVERIFY OP_CHECKSIG
, #2OP_DUP OP_HASH160 d75e9ee66820ab398f3f9e46c1ca455fe0f2fce0 OP_EQUALVERIFY OP_CHECKSIG
, #3OP_DUP OP_HASH160 013db704b9b14b56586fe1aedc0c6c4cfd91d0f4 OP_EQUALVERIFY OP_CHECKSIG
, #4OP_DUP OP_HASH160 fb502ea886903825b20e92839d919b548a6f6ac8 OP_EQUALVERIFY OP_CHECKSIG
, #5OP_DUP OP_HASH160 793bf52d7bde13ba5c1af7f7263af1cfa6df5cff OP_EQUALVERIFY OP_CHECKSIG
, #6OP_DUP OP_HASH160 c499bfa703cef8b33f9b163a195ad49efc7f6c9e OP_EQUALVERIFY OP_CHECKSIG
, #7OP_DUP OP_HASH160 1cdeb9eb5cd2b81d64b00940e49565e60db7a7ff OP_EQUALVERIFY OP_CHECKSIG
, #8OP_DUP OP_HASH160 e68661e64d235dd54bc102845f411802fcad8f63 OP_EQUALVERIFY OP_CHECKSIG
, #9OP_DUP OP_HASH160 f22c4373d9d438f6cb1c0841dc7e6104d11f6c0d OP_EQUALVERIFY OP_CHECKSIG
, #10OP_DUP OP_HASH160 ab01a9d202116b2be510abed8c5b14d41749ed0c OP_EQUALVERIFY OP_CHECKSIG
, #11OP_DUP OP_HASH160 6911aedf2341d8d4b0d3475eb891ddd94c12b423 OP_EQUALVERIFY OP_CHECKSIG
, #12OP_DUP OP_HASH160 0ce8116b3ab32af1a56c94501585babf6c119072 OP_EQUALVERIFY OP_CHECKSIG
, #13OP_DUP OP_HASH160 37fb35c8a77fb90566f6e7377781f7d965d1a88f OP_EQUALVERIFY OP_CHECKSIG
, #14OP_DUP OP_HASH160 42baeef063cd3abaabdc4e2d0ae434585077e319 OP_EQUALVERIFY OP_CHECKSIG
, #15OP_DUP OP_HASH160 71d34aca20fc0aaf881385a43607337ead25c971 OP_EQUALVERIFY OP_CHECKSIG
, #16OP_DUP OP_HASH160 9406a99a869e6f5a3d8224d5a1a5565e2541869d OP_EQUALVERIFY OP_CHECKSIG
, #17OP_DUP OP_HASH160 9cdcaece490604ef70425960fd1965ff86607821 OP_EQUALVERIFY OP_CHECKSIG
, #18OP_DUP OP_HASH160 e8a7536b61717c2f076ce3947edb2baf960f4a01 OP_EQUALVERIFY OP_CHECKSIG
, #19OP_DUP OP_HASH160 c365b305f8cc681282edeb54e8fe7208e8b22b68 OP_EQUALVERIFY OP_CHECKSIG
, #20OP_DUP OP_HASH160 31e9d50d0f7c2b90663358f5faa76b79152b0583 OP_EQUALVERIFY OP_CHECKSIG
, #21OP_DUP OP_HASH160 e5fcd6818189f96ad03c7bcd4525c32fc8d6cc2c OP_EQUALVERIFY OP_CHECKSIG
, #22OP_DUP OP_HASH160 348e8ac2041a1cc3f8d130f85b92ba7db77cd906 OP_EQUALVERIFY OP_CHECKSIG
, #23OP_DUP OP_HASH160 4d6098f33d541f9e62f370bf762af7b0c68bc5de OP_EQUALVERIFY OP_CHECKSIG
, #24OP_DUP OP_HASH160 49b9cdeb8fda45d76f9f1c082ae49b4c8cdc6a6e OP_EQUALVERIFY OP_CHECKSIG
, #25OP_DUP OP_HASH160 0d97813d7cb953db557da5f6cb8f5436b07b3b07 OP_EQUALVERIFY OP_CHECKSIG
, #26OP_DUP OP_HASH160 61703fc6ea76d653c7284588d880fae3ba93d567 OP_EQUALVERIFY OP_CHECKSIG
, #27OP_DUP OP_HASH160 01b977a81329d0e903fa2285fb2d8e317f15cd73 OP_EQUALVERIFY OP_CHECKSIG
, #28OP_DUP OP_HASH160 d0b108fb36803d366e8ee76f58415781d8f68dc0 OP_EQUALVERIFY OP_CHECKSIG
, #29OP_DUP OP_HASH160 dac9d86036d50fc50e14cff0fa57d03844396ca8 OP_EQUALVERIFY OP_CHECKSIG
, #30OP_DUP OP_HASH160 23577d96d644426b18488f20cc67c9cb8f532183 OP_EQUALVERIFY OP_CHECKSIG
, #31OP_DUP OP_HASH160 5350f9f5c8462f64d296b7bb1abcd492693986d0 OP_EQUALVERIFY OP_CHECKSIG
, #32OP_DUP OP_HASH160 8e6ff7fb9017270498942a6d71a8f92dbbedbfd6 OP_EQUALVERIFY OP_CHECKSIG
, #33OP_DUP OP_HASH160 d1990b3025dd770304dd2619b150130cccc97445 OP_EQUALVERIFY OP_CHECKSIG
, #34OP_DUP OP_HASH160 2e06e470c2fad340434bfc43fa0002fd2fb54c7e OP_EQUALVERIFY OP_CHECKSIG
, #35OP_DUP OP_HASH160 217c701662e9c313352e8617f4adca4454f2da3e OP_EQUALVERIFY OP_CHECKSIG
, #36OP_DUP OP_HASH160 32a5c928c805e9663330df4d7b8480bf957cb8bc OP_EQUALVERIFY OP_CHECKSIG
, #37OP_DUP OP_HASH160 f6c71b990456ff124d4eb9f6fefdc5e6fc5a9e6e OP_EQUALVERIFY OP_CHECKSIG
, #38OP_DUP OP_HASH160 3f6587e7ae507f70f7960e75566fef89adcb1202 OP_EQUALVERIFY OP_CHECKSIG
, #39OP_DUP OP_HASH160 f1195d9598cdc85964ff4e6ce058a96f40977429 OP_EQUALVERIFY OP_CHECKSIG
, #40OP_DUP OP_HASH160 cdd3995e980e4576a91b85bc23eca725dfc18601 OP_EQUALVERIFY OP_CHECKSIG
, #41OP_DUP OP_HASH160 079cc4c0cdddf4c6f338385907e530c57b82af73 OP_EQUALVERIFY OP_CHECKSIG
, #42OP_DUP OP_HASH160 33d7bdf0b0df0109f2ae0ba7e582dce94c26d0ba OP_EQUALVERIFY OP_CHECKSIG
, #43OP_DUP OP_HASH160 0efe43d45455d6c315d6d06913d8dfe35993c778 OP_EQUALVERIFY OP_CHECKSIG
, #44OP_DUP OP_HASH160 54c58c76ad467dd374ca28ebb6d2963a5e11e89a OP_EQUALVERIFY OP_CHECKSIG
, #45OP_DUP OP_HASH160 9ebef47b17517acb6574483a411fb69149151d83 OP_EQUALVERIFY OP_CHECKSIG

Transaction


{
    "txid": "acda713bb52dd7c43e73a52104835984b234c6f752b5d572d57ffb11c533d2f2",
    "hash": "acda713bb52dd7c43e73a52104835984b234c6f752b5d572d57ffb11c533d2f2",
    "version": 1,
    "size": 8074,
    "locktime": 0,
    "vin": [
        {
            "txid": "17fc8802c9fdcda875ea5f7fd3a10b55ac2eb3fb45c101dab26cd8e985c7b942",
            "vout": 9,
            "scriptSig": {
                "asm": "19c3e1ea9ed7e4f8d760082da1c2d83d03ad16cb60dac333a3e7c5f561a1276a83822d5ebea8cd31bedce7818b2f8845df82d080884aa2c0e2ecbf8b4d2e9c33[ALL|FORKID] 02105792f01a0493cd19698509ba57be9e15881af9957102c1c06b6a582abe8c79",
                "hex": "4119c3e1ea9ed7e4f8d760082da1c2d83d03ad16cb60dac333a3e7c5f561a1276a83822d5ebea8cd31bedce7818b2f8845df82d080884aa2c0e2ecbf8b4d2e9c33412102105792f01a0493cd19698509ba57be9e15881af9957102c1c06b6a582abe8c79"
            },
            "sequence": 4294967295
        },
        {
            "txid": "2228766e61c9af0c4d58ce17294b3e73177ab7348363676e9a828a085caba33d",
            "vout": 44,
            "scriptSig": {
                "asm": "0013f00452453341f3911299002fc8362915cb8df3fed4279942685d2fb0cf9606e3e1aa5000c285de7f824844fa58ca9d746308701533d3eecbab4f53b6b137[ALL|FORKID] 03a6a4f9bf118a74990dc56ff214a23244abcd7215f162260a07e116f36465f868",
                "hex": "410013f00452453341f3911299002fc8362915cb8df3fed4279942685d2fb0cf9606e3e1aa5000c285de7f824844fa58ca9d746308701533d3eecbab4f53b6b137412103a6a4f9bf118a74990dc56ff214a23244abcd7215f162260a07e116f36465f868"
            },
            "sequence": 4294967295
        },
        {
            "txid": "229e21cde79f2239528feb80705643c4e2f55f8e5f79a83e67e981dbfd34edfb",
            "vout": 29,
            "scriptSig": {
                "asm": "e986a00851238d48c6ecaebdcaddfafffe088f075259012117c272bb73e64cd01e9a707ffcb017d468edcebc265f9f3978195a5cd5cbe5ede38e3ce0cfcf409e[ALL|FORKID] 032e0c9bf69404e033e171e75d850176b3256348a0c9a9e45cf286962bd43d48ae",
                "hex": "41e986a00851238d48c6ecaebdcaddfafffe088f075259012117c272bb73e64cd01e9a707ffcb017d468edcebc265f9f3978195a5cd5cbe5ede38e3ce0cfcf409e4121032e0c9bf69404e033e171e75d850176b3256348a0c9a9e45cf286962bd43d48ae"
            },
            "sequence": 4294967295
        },
        {
            "txid": "229e21cde79f2239528feb80705643c4e2f55f8e5f79a83e67e981dbfd34edfb",
            "vout": 32,
            "scriptSig": {
                "asm": "838d0591451879a008f5c70970d600504251173681e09bc1012400cd3a4496a550f22cf5d60fc49be921efd27851a37bac6d2ecc2e8c7826108bf94673c769b8[ALL|FORKID] 02c72fbb98ef796270d44a971f15efeab25369e22c77b72ca5dd9fb1e0ad4f04f4",
                "hex": "41838d0591451879a008f5c70970d600504251173681e09bc1012400cd3a4496a550f22cf5d60fc49be921efd27851a37bac6d2ecc2e8c7826108bf94673c769b8412102c72fbb98ef796270d44a971f15efeab25369e22c77b72ca5dd9fb1e0ad4f04f4"
            },
            "sequence": 4294967295
        },
        {
            "txid": "229e21cde79f2239528feb80705643c4e2f55f8e5f79a83e67e981dbfd34edfb",
            "vout": 44,
            "scriptSig": {
                "asm": "61ecddaee7ae9e9e8ae9a5e0536ddf5cb3dd68b0244dd9effd353eeb8afcd41d7217ff49ac96c80c1e09c3fa05e7d8c5c98f210ab2c8f3c339b7a7000c64f2ca[ALL|FORKID] 03750674c62f32f6e15587d48c3b86ea18ce07abb477dcbf01adf1090548fc8c99",
                "hex": "4161ecddaee7ae9e9e8ae9a5e0536ddf5cb3dd68b0244dd9effd353eeb8afcd41d7217ff49ac96c80c1e09c3fa05e7d8c5c98f210ab2c8f3c339b7a7000c64f2ca412103750674c62f32f6e15587d48c3b86ea18ce07abb477dcbf01adf1090548fc8c99"
            },
            "sequence": 4294967295
        },
        {
            "txid": "229e21cde79f2239528feb80705643c4e2f55f8e5f79a83e67e981dbfd34edfb",
            "vout": 46,
            "scriptSig": {
                "asm": "2db03e2bc220a2c120ddd699887d5a4e7eabb31141271dca9e5548a3ca10656ad15b582a6f49c9fea37fdc973920868fb25357bfff8826a606e23a57d165185b[ALL|FORKID] 0255be8270cd432b9419db34577ed1ce5841f229c41148f3457b3095f7bd33f095",
                "hex": "412db03e2bc220a2c120ddd699887d5a4e7eabb31141271dca9e5548a3ca10656ad15b582a6f49c9fea37fdc973920868fb25357bfff8826a606e23a57d165185b41210255be8270cd432b9419db34577ed1ce5841f229c41148f3457b3095f7bd33f095"
            },
            "sequence": 4294967295
        },
        {
            "txid": "229e21cde79f2239528feb80705643c4e2f55f8e5f79a83e67e981dbfd34edfb",
            "vout": 53,
            "scriptSig": {
                "asm": "9f949837d3c6334d11d9c446c3daa5e2101a416aca93d35a602894d553ba0d61d90bfc4cad764e2369d9c25cd41a352ebe36bb7e9dd5a29ade784c58e88a3482[ALL|FORKID] 03168a81409d3eb5851f30cd3f01da1cfb3779a239d3b2d20e99029a38d4e20094",
                "hex": "419f949837d3c6334d11d9c446c3daa5e2101a416aca93d35a602894d553ba0d61d90bfc4cad764e2369d9c25cd41a352ebe36bb7e9dd5a29ade784c58e88a3482412103168a81409d3eb5851f30cd3f01da1cfb3779a239d3b2d20e99029a38d4e20094"
            },
            "sequence": 4294967295
        },
        {
            "txid": "4293bb68fb57b5bcc4d78964ee2c00204f60121ee668135a0b30a99705a1fe61",
            "vout": 9,
            "scriptSig": {
                "asm": "5d84e68a797b70b602c914af24f3baaa4edb6cf0aceedbdb7b0ee5a0c9a30217695147749c342afb4088519a19a34e36bfd101cb4e5f0bf980f9db5aeb1fae38[ALL|FORKID] 0386caf234ef321cd0e8f338115cf48681f8acd02bc44699744ba0143574c3a479",
                "hex": "415d84e68a797b70b602c914af24f3baaa4edb6cf0aceedbdb7b0ee5a0c9a30217695147749c342afb4088519a19a34e36bfd101cb4e5f0bf980f9db5aeb1fae3841210386caf234ef321cd0e8f338115cf48681f8acd02bc44699744ba0143574c3a479"
            },
            "sequence": 4294967295
        },
        {
            "txid": "5e3e5399c892edd11fa16dfd170bb894bb1b5481443d3aa4c89f3c0ddff79613",
            "vout": 12,
            "scriptSig": {
                "asm": "c69af4483857bbf1edad0af60f60d7efd6f5bdfa50f242022dae2bfdc5a620590e8e436b12ed96c8025c48c3744b1a621f5aa9265864e5eb9a5ecaec742cdcc3[ALL|FORKID] 030a0cb5603fed0ef228876f13090e88b9b1e2847e7dccfd4dd52ac14870f59834",
                "hex": "41c69af4483857bbf1edad0af60f60d7efd6f5bdfa50f242022dae2bfdc5a620590e8e436b12ed96c8025c48c3744b1a621f5aa9265864e5eb9a5ecaec742cdcc34121030a0cb5603fed0ef228876f13090e88b9b1e2847e7dccfd4dd52ac14870f59834"
            },
            "sequence": 4294967295
        },
        {
            "txid": "63c90de9d2804bbff1249e44dd9220eeb51db5953b1735859822356b6d032714",
            "vout": 30,
            "scriptSig": {
                "asm": "92ae497fdbc60112ca96790856214ea7a69dfe6825f3f5f990f92060acf367ee9cb59eed93b8249ebfd2161d1fa4fc2ad19d5e5fa2589198a73833dfed9bcb93[ALL|FORKID] 0247acdbfdda61241f4451729e8f04465657273f80a1919e58474d5e5b9c356e76",
                "hex": "4192ae497fdbc60112ca96790856214ea7a69dfe6825f3f5f990f92060acf367ee9cb59eed93b8249ebfd2161d1fa4fc2ad19d5e5fa2589198a73833dfed9bcb9341210247acdbfdda61241f4451729e8f04465657273f80a1919e58474d5e5b9c356e76"
            },
            "sequence": 4294967295
        },
        {
            "txid": "73d970697a46e639fb4790a3f9a9c9fcd09f3e81d8b24501003acee2e8cfc77a",
            "vout": 46,
            "scriptSig": {
                "asm": "e389da2b9ecbe9044dbb6872a72492a919681e4eb1898b30e87d432ad2606398e0de06c4638578678acb4815847c1e966a8486125f0b6ecd738b92cd1dadb1fe[ALL|FORKID] 03b59be878fd25b40719d79290fbf916edb2c1c1b16156a43dbd5f577687053fac",
                "hex": "41e389da2b9ecbe9044dbb6872a72492a919681e4eb1898b30e87d432ad2606398e0de06c4638578678acb4815847c1e966a8486125f0b6ecd738b92cd1dadb1fe412103b59be878fd25b40719d79290fbf916edb2c1c1b16156a43dbd5f577687053fac"
            },
            "sequence": 4294967295
        },
        {
            "txid": "78465e048e9307cfc2bd0c23f943890dbe742c0714c7f5ba8b07bc06ac26855d",
            "vout": 8,
            "scriptSig": {
                "asm": "53fa14581c6c5f26289efc2e3532bcf1114287bb8965655ffd283b6f88c22fad8fe2ee2a343c3596dd8309862f853198f6dd4326558a0d9fa81287fb3dc586e3[ALL|FORKID] 03cac0e28f52bd194c73004b2ba298638a6aa374c88fe1a25afe7921410c811967",
                "hex": "4153fa14581c6c5f26289efc2e3532bcf1114287bb8965655ffd283b6f88c22fad8fe2ee2a343c3596dd8309862f853198f6dd4326558a0d9fa81287fb3dc586e3412103cac0e28f52bd194c73004b2ba298638a6aa374c88fe1a25afe7921410c811967"
            },
            "sequence": 4294967295
        },
        {
            "txid": "78465e048e9307cfc2bd0c23f943890dbe742c0714c7f5ba8b07bc06ac26855d",
            "vout": 17,
            "scriptSig": {
                "asm": "e2e27648342f377307c64b6aafa399ff6254e78afccbadda4acb5c93c56b64a3a4326241305c688385bc4ead7e56432f220f7a741e95318439333ac247d34e7e[ALL|FORKID] 0237f26bc7d47d64eaae12adf28385440c71846933bdf6d2f2eea778521ba68531",
                "hex": "41e2e27648342f377307c64b6aafa399ff6254e78afccbadda4acb5c93c56b64a3a4326241305c688385bc4ead7e56432f220f7a741e95318439333ac247d34e7e41210237f26bc7d47d64eaae12adf28385440c71846933bdf6d2f2eea778521ba68531"
            },
            "sequence": 4294967295
        },
        {
            "txid": "803cccbb5ad17db301f7d5f7d0abe68b47d727064abe0951c4118ecdf288a870",
            "vout": 8,
            "scriptSig": {
                "asm": "1f127bf5c1621c847f1035c7ab0b974fb012a53a4d74af2ebf234b9dca8d0627314bd1380a23f988a1eb924b7e8d835b18010d66d4879066ec86fdf0ac464335[ALL|FORKID] 030aacbacf8a4e54e50c15e90fd9fa70bbbd5125de094fc8971cf45ea1f7c8080e",
                "hex": "411f127bf5c1621c847f1035c7ab0b974fb012a53a4d74af2ebf234b9dca8d0627314bd1380a23f988a1eb924b7e8d835b18010d66d4879066ec86fdf0ac4643354121030aacbacf8a4e54e50c15e90fd9fa70bbbd5125de094fc8971cf45ea1f7c8080e"
            },
            "sequence": 4294967295
        },
        {
            "txid": "803cccbb5ad17db301f7d5f7d0abe68b47d727064abe0951c4118ecdf288a870",
            "vout": 9,
            "scriptSig": {
                "asm": "b515c4c29a05cfb202beb1d7cdf46afa5b83e16b68210a418edb8dc9b78a6668da02361e6086d2f247855cbed7fe5675409dad2bdfe892a5636b16b6194c47ea[ALL|FORKID] 0281f102a57397b784c3df2c12c282bafa09a771bcb9fa0c97d5eddf3d80bdc8ab",
                "hex": "41b515c4c29a05cfb202beb1d7cdf46afa5b83e16b68210a418edb8dc9b78a6668da02361e6086d2f247855cbed7fe5675409dad2bdfe892a5636b16b6194c47ea41210281f102a57397b784c3df2c12c282bafa09a771bcb9fa0c97d5eddf3d80bdc8ab"
            },
            "sequence": 4294967295
        },
        {
            "txid": "803cccbb5ad17db301f7d5f7d0abe68b47d727064abe0951c4118ecdf288a870",
            "vout": 11,
            "scriptSig": {
                "asm": "bcdb38f9b1363ece1b6471807b1b5bb379b0515afdd1fdc05a91b02145811cf88b6045a377eaff1d4a0a4b78c17922795beebb8bd9f76e8a958a677fd5d562ba[ALL|FORKID] 030dcc81b66e218c3455bb21f6861dc861e577f1603830d97d72d34e72b9ac6968",
                "hex": "41bcdb38f9b1363ece1b6471807b1b5bb379b0515afdd1fdc05a91b02145811cf88b6045a377eaff1d4a0a4b78c17922795beebb8bd9f76e8a958a677fd5d562ba4121030dcc81b66e218c3455bb21f6861dc861e577f1603830d97d72d34e72b9ac6968"
            },
            "sequence": 4294967295
        },
        {
            "txid": "803cccbb5ad17db301f7d5f7d0abe68b47d727064abe0951c4118ecdf288a870",
            "vout": 15,
            "scriptSig": {
                "asm": "6f683ef158e38c701934638eda0728be44c4e6ce2e27f446bbc8b7ca2a790a9dbb4bacd08209de0db1f77f2c2b80f7309bcb8537285e7b1501339384fdb9a266[ALL|FORKID] 03f3fa4089d439011523fc2d566d13f1b523e53ecc30599d7a6c649fd082ae8f79",
                "hex": "416f683ef158e38c701934638eda0728be44c4e6ce2e27f446bbc8b7ca2a790a9dbb4bacd08209de0db1f77f2c2b80f7309bcb8537285e7b1501339384fdb9a266412103f3fa4089d439011523fc2d566d13f1b523e53ecc30599d7a6c649fd082ae8f79"
            },
            "sequence": 4294967295
        },
        {
            "txid": "803cccbb5ad17db301f7d5f7d0abe68b47d727064abe0951c4118ecdf288a870",
            "vout": 28,
            "scriptSig": {
                "asm": "0c4406667f99a3a24e094d036babd4dcf27a4988b906b4952b364816e246d6495a0f6dafbd94fe2efcd3a4433c941b4e3e862637a39875b596fa7a488c7a2143[ALL|FORKID] 02ef7adb0b4a83a5f8325505e61f17eb7e4d71bdd777f1e131cec421e6ca65b22f",
                "hex": "410c4406667f99a3a24e094d036babd4dcf27a4988b906b4952b364816e246d6495a0f6dafbd94fe2efcd3a4433c941b4e3e862637a39875b596fa7a488c7a2143412102ef7adb0b4a83a5f8325505e61f17eb7e4d71bdd777f1e131cec421e6ca65b22f"
            },
            "sequence": 4294967295
        },
        {
            "txid": "878ee098cec921c05cf6182829ab3b87a8482072d2373d34ab4ff5a9f126bfb8",
            "vout": 7,
            "scriptSig": {
                "asm": "e6c6d783b5073c0742ff54132c5b1b0766e1d23a5322ef1bf1f6ce464c4c8a6bcdf6876e86c4a412518119a1381eb6622f3f273be7a9274b3b75ade89c1ddc02[ALL|FORKID] 03ad0ab9ef0608bc3a7a425875700e1ef5141e293ab3c62a9f38520936dddafc12",
                "hex": "41e6c6d783b5073c0742ff54132c5b1b0766e1d23a5322ef1bf1f6ce464c4c8a6bcdf6876e86c4a412518119a1381eb6622f3f273be7a9274b3b75ade89c1ddc02412103ad0ab9ef0608bc3a7a425875700e1ef5141e293ab3c62a9f38520936dddafc12"
            },
            "sequence": 4294967295
        },
        {
            "txid": "9e8bac24f6186d9c95c6607348866307e7395d78cea92312b70583a71aa07a18",
            "vout": 4,
            "scriptSig": {
                "asm": "85740696857ec49e6cfdb0356ae4347c6c45c2ff2e7c7c54a95393b208d2da83a4dbe69b9a12eef9aa53afc1db223ca3b2a49490b0f4031537a00e225cabdd3e[ALL|FORKID] 02c28801a5f2e231087dba3aedab1d6c440e0f98c3fa38ca4a00c0100c62ddc0ff",
                "hex": "4185740696857ec49e6cfdb0356ae4347c6c45c2ff2e7c7c54a95393b208d2da83a4dbe69b9a12eef9aa53afc1db223ca3b2a49490b0f4031537a00e225cabdd3e412102c28801a5f2e231087dba3aedab1d6c440e0f98c3fa38ca4a00c0100c62ddc0ff"
            },
            "sequence": 4294967295
        },
        {
            "txid": "a50db73dfe0bdee0ae094fec71325dce96775c42fa971b156b38288516d54baa",
            "vout": 39,
            "scriptSig": {
                "asm": "6c2f5320111a1122efc643dfb2f6342d44334cd4bfe24afcde10cdfa72077f00bca0e894d7bdd317900aa0a43603227856e0d5f99b7cfe99c109407f7d665650[ALL|FORKID] 036fd2304b7eabb4675ad63ee6f3fa81c87f8faf37bf18dc2906f47333a4a03dab",
                "hex": "416c2f5320111a1122efc643dfb2f6342d44334cd4bfe24afcde10cdfa72077f00bca0e894d7bdd317900aa0a43603227856e0d5f99b7cfe99c109407f7d6656504121036fd2304b7eabb4675ad63ee6f3fa81c87f8faf37bf18dc2906f47333a4a03dab"
            },
            "sequence": 4294967295
        },
        {
            "txid": "a50db73dfe0bdee0ae094fec71325dce96775c42fa971b156b38288516d54baa",
            "vout": 45,
            "scriptSig": {
                "asm": "1db90a12d709a501212172caf671539c12ab88935ba851cfabc81e5cef9aab15b9b31234b2853ac545df4bd5d55499e77c108b302bc850b67d5eb952d4b02cc0[ALL|FORKID] 0394e2d7151be508e3ae3735e42be829645d76585756b75f54fbd1a8a8e8dc835d",
                "hex": "411db90a12d709a501212172caf671539c12ab88935ba851cfabc81e5cef9aab15b9b31234b2853ac545df4bd5d55499e77c108b302bc850b67d5eb952d4b02cc041210394e2d7151be508e3ae3735e42be829645d76585756b75f54fbd1a8a8e8dc835d"
            },
            "sequence": 4294967295
        },
        {
            "txid": "a50db73dfe0bdee0ae094fec71325dce96775c42fa971b156b38288516d54baa",
            "vout": 51,
            "scriptSig": {
                "asm": "50343bf802315b3d83adef4031313fb3e5379bbefa9ff2c36b983918e2c09841f4c04e234a597dc838847d9c488676a8a46c0eda9e369524c171be8381d711ca[ALL|FORKID] 021eead4e66e4601c68ccda0ddddddf464d695e115861ce9679779f6cbc6f11388",
                "hex": "4150343bf802315b3d83adef4031313fb3e5379bbefa9ff2c36b983918e2c09841f4c04e234a597dc838847d9c488676a8a46c0eda9e369524c171be8381d711ca4121021eead4e66e4601c68ccda0ddddddf464d695e115861ce9679779f6cbc6f11388"
            },
            "sequence": 4294967295
        },
        {
            "txid": "b774313fec6a40d19148e5c1d7a9a4e623df695e5d416586b93b3bea6e04d925",
            "vout": 14,
            "scriptSig": {
                "asm": "684b57cbba0f68036262d1ac065c5992bad5abf6072e4297b1a7765f693bb4ebea1eaa8eefeefc1114b4206e155fe3792d3b2e88a1535a7d682eefdd4ae262af[ALL|FORKID] 024809c959c890757968daee0e5a01ea357defdf8219eab90fc2ca51eee8178380",
                "hex": "41684b57cbba0f68036262d1ac065c5992bad5abf6072e4297b1a7765f693bb4ebea1eaa8eefeefc1114b4206e155fe3792d3b2e88a1535a7d682eefdd4ae262af4121024809c959c890757968daee0e5a01ea357defdf8219eab90fc2ca51eee8178380"
            },
            "sequence": 4294967295
        },
        {
            "txid": "b774313fec6a40d19148e5c1d7a9a4e623df695e5d416586b93b3bea6e04d925",
            "vout": 40,
            "scriptSig": {
                "asm": "c684f9554dede4ada5004659b90df87a0f9bf3f254c329efb2bc7f2ffdf25b042821d476baa3b1d5f558b5eb04c0ececc59d51bd4b5fef30f9e7ed5550ca8472[ALL|FORKID] 032043dad8f4aa7eb5e87b42d662549e7a985f945e566ed7d06da58a790e2ed968",
                "hex": "41c684f9554dede4ada5004659b90df87a0f9bf3f254c329efb2bc7f2ffdf25b042821d476baa3b1d5f558b5eb04c0ececc59d51bd4b5fef30f9e7ed5550ca84724121032043dad8f4aa7eb5e87b42d662549e7a985f945e566ed7d06da58a790e2ed968"
            },
            "sequence": 4294967295
        },
        {
            "txid": "b774313fec6a40d19148e5c1d7a9a4e623df695e5d416586b93b3bea6e04d925",
            "vout": 81,
            "scriptSig": {
                "asm": "95ef6f13a456aeb1d09c3a4f25334619dbfa721eea43fd541fff13197c1f21df6cf6e798b8448f6dd96c8cbff601ec1d6745a31cf1ab3b24ba720fe0bc32d9ce[ALL|FORKID] 02b4bc1b339abaa6575e5dcd58a24be28d75d9d9b9ee89db46b363ae99d62ac8a6",
                "hex": "4195ef6f13a456aeb1d09c3a4f25334619dbfa721eea43fd541fff13197c1f21df6cf6e798b8448f6dd96c8cbff601ec1d6745a31cf1ab3b24ba720fe0bc32d9ce412102b4bc1b339abaa6575e5dcd58a24be28d75d9d9b9ee89db46b363ae99d62ac8a6"
            },
            "sequence": 4294967295
        },
        {
            "txid": "ba418e55b565f60a75a7c924945fe1a89fbf59886da28fa4e45d4b6986c5bdb1",
            "vout": 15,
            "scriptSig": {
                "asm": "463c5d017801dab770d63a42ac138524513903a5240c0668ed63b806927657d522101dba912c9e364623eeaf8e8a868b4c495b9eb1d263d7ff444b90864bd7c9[ALL|FORKID] 03eb30c0cdf651a033a647e86dbad331be7320eef8aa2da0c908fa1983ced8c6e2",
                "hex": "41463c5d017801dab770d63a42ac138524513903a5240c0668ed63b806927657d522101dba912c9e364623eeaf8e8a868b4c495b9eb1d263d7ff444b90864bd7c9412103eb30c0cdf651a033a647e86dbad331be7320eef8aa2da0c908fa1983ced8c6e2"
            },
            "sequence": 4294967295
        },
        {
            "txid": "ba418e55b565f60a75a7c924945fe1a89fbf59886da28fa4e45d4b6986c5bdb1",
            "vout": 22,
            "scriptSig": {
                "asm": "12209ca22b888a4e6da118031578c4623ec88d7e94cc5e3d87c3f5613b524606760ba3a6b9e79450b519072a4a4e90bae94b48d58c4c693ae0097d9508130018[ALL|FORKID] 03311a9459a479923e51e4e2774405a2af01a1793bb663f2864cbf8233ee97eeec",
                "hex": "4112209ca22b888a4e6da118031578c4623ec88d7e94cc5e3d87c3f5613b524606760ba3a6b9e79450b519072a4a4e90bae94b48d58c4c693ae0097d9508130018412103311a9459a479923e51e4e2774405a2af01a1793bb663f2864cbf8233ee97eeec"
            },
            "sequence": 4294967295
        },
        {
            "txid": "ba9633d8280b43caadabf1e00eec1be88001f0a6d90df3a2e4ac06110c4b33fb",
            "vout": 24,
            "scriptSig": {
                "asm": "5e562d61d13a70c288c07de9e05554c183ef5be99b26fc13e6afcf86def6290cdcad7590aaef3efdd018a558420257e0e889867a10de4589559e3ba8ad7b91c0[ALL|FORKID] 02173612cd9fd086509df83a4f888b700aa058756d9cc8c74993c901b4adbc675f",
                "hex": "415e562d61d13a70c288c07de9e05554c183ef5be99b26fc13e6afcf86def6290cdcad7590aaef3efdd018a558420257e0e889867a10de4589559e3ba8ad7b91c0412102173612cd9fd086509df83a4f888b700aa058756d9cc8c74993c901b4adbc675f"
            },
            "sequence": 4294967295
        },
        {
            "txid": "ba9633d8280b43caadabf1e00eec1be88001f0a6d90df3a2e4ac06110c4b33fb",
            "vout": 40,
            "scriptSig": {
                "asm": "836f7ff51456eb33a265f4e588909ab2143c99ef9ca5133131783571bc7008d73db97f947d294f60d68a8d1ad8e59c5cb27895d5de5ae982dcdf151e8635191e[ALL|FORKID] 03f3142df0e6a05a2db0991e65ea017079cfb0382a9394ed5fc11568c98bc67066",
                "hex": "41836f7ff51456eb33a265f4e588909ab2143c99ef9ca5133131783571bc7008d73db97f947d294f60d68a8d1ad8e59c5cb27895d5de5ae982dcdf151e8635191e412103f3142df0e6a05a2db0991e65ea017079cfb0382a9394ed5fc11568c98bc67066"
            },
            "sequence": 4294967295
        },
        {
            "txid": "bdf88522d3db09dffaf6a4bb3dd189453b5a7d9a67a17f3a7cc6b36ed027963a",
            "vout": 44,
            "scriptSig": {
                "asm": "75e62e31a83fdde2cfa04c5ec14ce73209939f6b683ebbab24713f9391b279960b511d0be24f7f59dba5eb6f1f28331175419bd0836f180eec8c39e3ed60ccc8[ALL|FORKID] 02f2de07ea4d810f26e44f9916527c2e2d6788672cf7fb6e8e7db713752e53923b",
                "hex": "4175e62e31a83fdde2cfa04c5ec14ce73209939f6b683ebbab24713f9391b279960b511d0be24f7f59dba5eb6f1f28331175419bd0836f180eec8c39e3ed60ccc8412102f2de07ea4d810f26e44f9916527c2e2d6788672cf7fb6e8e7db713752e53923b"
            },
            "sequence": 4294967295
        },
        {
            "txid": "bdf88522d3db09dffaf6a4bb3dd189453b5a7d9a67a17f3a7cc6b36ed027963a",
            "vout": 93,
            "scriptSig": {
                "asm": "9459e9caa64eed155109b86bd6fa7c681d056647e2b3a611a1d1104486643a237cd4b833ba92eba9135080107271fdaf1a03accee1f049378ccea91109a5565f[ALL|FORKID] 03dd4e1933febabf22b085dea3d5ae87f9c68a50282ab03b893e7b2d3e48117783",
                "hex": "419459e9caa64eed155109b86bd6fa7c681d056647e2b3a611a1d1104486643a237cd4b833ba92eba9135080107271fdaf1a03accee1f049378ccea91109a5565f412103dd4e1933febabf22b085dea3d5ae87f9c68a50282ab03b893e7b2d3e48117783"
            },
            "sequence": 4294967295
        },
        {
            "txid": "bdf88522d3db09dffaf6a4bb3dd189453b5a7d9a67a17f3a7cc6b36ed027963a",
            "vout": 96,
            "scriptSig": {
                "asm": "3feed27a60e6790b0b950b1e20839f87ccf21af644074c7548d7490238963d4606fa588802f280d1a0ee1e665f74454810fa04a758e0adb4ad2566d0376b48df[ALL|FORKID] 03d30e63a51dd5b0fafd6ec8025189c3cf47e35b08f47e64011e5c6d3c5df9d559",
                "hex": "413feed27a60e6790b0b950b1e20839f87ccf21af644074c7548d7490238963d4606fa588802f280d1a0ee1e665f74454810fa04a758e0adb4ad2566d0376b48df412103d30e63a51dd5b0fafd6ec8025189c3cf47e35b08f47e64011e5c6d3c5df9d559"
            },
            "sequence": 4294967295
        },
        {
            "txid": "bf8bfdeacdea3bfc8f0bf1f6e6f60bcaedc39e4c538d8fe0400edccab3f1537d",
            "vout": 1,
            "scriptSig": {
                "asm": "64be71292ddfd6e9746dc08850766e91bb1cb5cef0ca0ea4db1478035a94ca84b7ad3a7a104a73560cb8a9f386d0dc9e19fe0fbecc272d96020707b01851aa44[ALL|FORKID] 020b98a876ce418d27208fd0693e3855fd583574ec719cc93248137b4af26fdbcd",
                "hex": "4164be71292ddfd6e9746dc08850766e91bb1cb5cef0ca0ea4db1478035a94ca84b7ad3a7a104a73560cb8a9f386d0dc9e19fe0fbecc272d96020707b01851aa444121020b98a876ce418d27208fd0693e3855fd583574ec719cc93248137b4af26fdbcd"
            },
            "sequence": 4294967295
        },
        {
            "txid": "cf0cefcd1c0a4213f3ca94cf0805a8ffa3c6454350594267136ac3bd496ea4f9",
            "vout": 10,
            "scriptSig": {
                "asm": "fb5fb146938897a3d52e8a3042e1d198c4d9f8a7ecbdf38b5c0e152bb94558e024bb5493313cf66aba70231323cb83de9312cbac78dc76aa26eb5425296233c3[ALL|FORKID] 02034616155fcd1e1bed39b790a75bd3257435511d047276008c9f6dc1923c7a69",
                "hex": "41fb5fb146938897a3d52e8a3042e1d198c4d9f8a7ecbdf38b5c0e152bb94558e024bb5493313cf66aba70231323cb83de9312cbac78dc76aa26eb5425296233c3412102034616155fcd1e1bed39b790a75bd3257435511d047276008c9f6dc1923c7a69"
            },
            "sequence": 4294967295
        },
        {
            "txid": "cf0cefcd1c0a4213f3ca94cf0805a8ffa3c6454350594267136ac3bd496ea4f9",
            "vout": 11,
            "scriptSig": {
                "asm": "69ea493fb3a8a152a9dc40b0b12975f7b4ec1599238c8c6a448be5da23eceb8f6e8f813d126b2a0ac9b0c4d8e42b137222ff95907d68381a8d6e1eb737da2cde[ALL|FORKID] 032ec5bc4dc5b2fe7255f36fef71bd922b1812084119fbd9c52a92756fc3e9ec4e",
                "hex": "4169ea493fb3a8a152a9dc40b0b12975f7b4ec1599238c8c6a448be5da23eceb8f6e8f813d126b2a0ac9b0c4d8e42b137222ff95907d68381a8d6e1eb737da2cde4121032ec5bc4dc5b2fe7255f36fef71bd922b1812084119fbd9c52a92756fc3e9ec4e"
            },
            "sequence": 4294967295
        },
        {
            "txid": "cf0cefcd1c0a4213f3ca94cf0805a8ffa3c6454350594267136ac3bd496ea4f9",
            "vout": 20,
            "scriptSig": {
                "asm": "9c3a911e18e32b2e1613b9e3dea692025827a5d9f48a4b02d6c04ae419e78bc2c530f11d9180f8510a2ff1c33a8616d860d30eb05587469db3bbbc4612b829de[ALL|FORKID] 031f6d95094c335fdcf558fd92a27c95d498f0f5e4752b48b1207b36f7dffc44bc",
                "hex": "419c3a911e18e32b2e1613b9e3dea692025827a5d9f48a4b02d6c04ae419e78bc2c530f11d9180f8510a2ff1c33a8616d860d30eb05587469db3bbbc4612b829de4121031f6d95094c335fdcf558fd92a27c95d498f0f5e4752b48b1207b36f7dffc44bc"
            },
            "sequence": 4294967295
        },
        {
            "txid": "d95b93625860a98fb0de6920da1f8197cece0bcef7a7f70fd53aaead43651065",
            "vout": 81,
            "scriptSig": {
                "asm": "5b1a732d13ad47469ddc736365c9626df6d3172310e5b0f615e7c9b49aa1a557b8420969debb1eac48430be280c3554bc3465a6836b5ac07e13c7f8200e1764e[ALL|FORKID] 022909c62b2800fbf38bbba317d69595ca43d178592c5e066fdd6ad46d390128fb",
                "hex": "415b1a732d13ad47469ddc736365c9626df6d3172310e5b0f615e7c9b49aa1a557b8420969debb1eac48430be280c3554bc3465a6836b5ac07e13c7f8200e1764e4121022909c62b2800fbf38bbba317d69595ca43d178592c5e066fdd6ad46d390128fb"
            },
            "sequence": 4294967295
        },
        {
            "txid": "da5a71e390a5ca32109b18258e9ca0551ac580f765c81c3c98d3643d52b1755c",
            "vout": 46,
            "scriptSig": {
                "asm": "af68ac31028479b21f5ae91fa3d22d094c86baadc3fffc2f0968c12ad5e72b881934d12f395c6dc5819cd7a3c8d987228602ea42f9810f540b40a7dd4a53af67[ALL|FORKID] 02561b36b5462c0d7ba632f777ae0aacb29d3a5e6bdc6120d9431f18e66f3f587d",
                "hex": "41af68ac31028479b21f5ae91fa3d22d094c86baadc3fffc2f0968c12ad5e72b881934d12f395c6dc5819cd7a3c8d987228602ea42f9810f540b40a7dd4a53af67412102561b36b5462c0d7ba632f777ae0aacb29d3a5e6bdc6120d9431f18e66f3f587d"
            },
            "sequence": 4294967295
        },
        {
            "txid": "dbae7c88407c3f2e56599d3af89d1b56fccf378a2311a4fe6293fd9db1048b85",
            "vout": 13,
            "scriptSig": {
                "asm": "ef7d89adabf992582e3cedac30fe3cbc8de46e7e54958dc5411b211f2bab41db55808c8097e5187c3f4b0fe06d7a4c56978b7d934c0dc5deeba99bc56db76f3a[ALL|FORKID] 036f32cfef910220b4fa0d5378065a4f8d57715cbfbef8acd36422e40d992dc03b",
                "hex": "41ef7d89adabf992582e3cedac30fe3cbc8de46e7e54958dc5411b211f2bab41db55808c8097e5187c3f4b0fe06d7a4c56978b7d934c0dc5deeba99bc56db76f3a4121036f32cfef910220b4fa0d5378065a4f8d57715cbfbef8acd36422e40d992dc03b"
            },
            "sequence": 4294967295
        },
        {
            "txid": "e7facf312fa4e886d18865ee6a48e51c85583c360519a1730c545904b6eed642",
            "vout": 14,
            "scriptSig": {
                "asm": "c21e72b9f34bc18e849c2660c0b130f71270c1fffa017556e45fc8dd5ad02bb1fded528ec7c4c6bdfc351089a984cfeb6a43ceead5c0b6e28d5a3f9ea21d547e[ALL|FORKID] 0304884cdaa6ca2375866f65402b397984f88583025042cd4c57f870595c421d18",
                "hex": "41c21e72b9f34bc18e849c2660c0b130f71270c1fffa017556e45fc8dd5ad02bb1fded528ec7c4c6bdfc351089a984cfeb6a43ceead5c0b6e28d5a3f9ea21d547e41210304884cdaa6ca2375866f65402b397984f88583025042cd4c57f870595c421d18"
            },
            "sequence": 4294967295
        },
        {
            "txid": "e7facf312fa4e886d18865ee6a48e51c85583c360519a1730c545904b6eed642",
            "vout": 19,
            "scriptSig": {
                "asm": "b72bc232aecab332c45667d5663ef37f86025a074461687b135e3ec272c41d3539cf4228f89794a937e5a12cd32bcff08251d3a55401fa9ac6921a41f20a116c[ALL|FORKID] 03946e8a3b71b6886df066589596ab6cfb8f5995c2a635b88ecce52211c139ab84",
                "hex": "41b72bc232aecab332c45667d5663ef37f86025a074461687b135e3ec272c41d3539cf4228f89794a937e5a12cd32bcff08251d3a55401fa9ac6921a41f20a116c412103946e8a3b71b6886df066589596ab6cfb8f5995c2a635b88ecce52211c139ab84"
            },
            "sequence": 4294967295
        },
        {
            "txid": "e7facf312fa4e886d18865ee6a48e51c85583c360519a1730c545904b6eed642",
            "vout": 28,
            "scriptSig": {
                "asm": "7ca2ba78e7dc92ed39a42ebfaf49a6455c07c8c8a2364bbfdddb7a5cf99ae35bd5fab4acc3abc8a2fdd6b4d23896f855cdc85b464ae85f4688b357b251e1517d[ALL|FORKID] 021056618df94fbe9c9a327758ffe35fbf3684ae9d5b5c47f61592d07fce8c0dd6",
                "hex": "417ca2ba78e7dc92ed39a42ebfaf49a6455c07c8c8a2364bbfdddb7a5cf99ae35bd5fab4acc3abc8a2fdd6b4d23896f855cdc85b464ae85f4688b357b251e1517d4121021056618df94fbe9c9a327758ffe35fbf3684ae9d5b5c47f61592d07fce8c0dd6"
            },
            "sequence": 4294967295
        },
        {
            "txid": "ef569fcc89600629cf5bf506a971d06ee4f1be9aed9649a70b7264d546f2ac08",
            "vout": 32,
            "scriptSig": {
                "asm": "e73f3d61b99d45a9429be0bdbbcb2bda77384c6feb37a6a3de0329a7cc03cccbed08930769f6ed51ed68f52ac2ef9ed10409b267425d797f40afcf699effd48e[ALL|FORKID] 03bfe0cbc3b88241f098c4824c995873f0b9ad25099f16de9286dafb3533faea88",
                "hex": "41e73f3d61b99d45a9429be0bdbbcb2bda77384c6feb37a6a3de0329a7cc03cccbed08930769f6ed51ed68f52ac2ef9ed10409b267425d797f40afcf699effd48e412103bfe0cbc3b88241f098c4824c995873f0b9ad25099f16de9286dafb3533faea88"
            },
            "sequence": 4294967295
        },
        {
            "txid": "f4f1037afa670c0a804fa614a2cbd662581248dbd2758842e3e410e5859724a1",
            "vout": 2,
            "scriptSig": {
                "asm": "0c9af0e0795b433b8ae41ed9aa386a95ef7600b73c7a86c86036bc6c19bed600c8ade6533e81fc4f0720c117225c49497518b346475b8d980f1492937eff73ca[ALL|FORKID] 0293a07ccb936c98578d5149fc611d688d6baecac80c44b4677411a852572fd160",
                "hex": "410c9af0e0795b433b8ae41ed9aa386a95ef7600b73c7a86c86036bc6c19bed600c8ade6533e81fc4f0720c117225c49497518b346475b8d980f1492937eff73ca41210293a07ccb936c98578d5149fc611d688d6baecac80c44b4677411a852572fd160"
            },
            "sequence": 4294967295
        },
        {
            "txid": "f4f1037afa670c0a804fa614a2cbd662581248dbd2758842e3e410e5859724a1",
            "vout": 65,
            "scriptSig": {
                "asm": "225c89cdd51b25e58574d6270ab2a6d350dfd3a81adecb4bcb26ac1359dd1246ab018ecffe63c18605d8abde2ac85d29c5b6efb0586a9118f179772fcb9078cd[ALL|FORKID] 038b7b11d0adbe61248760d4732cd6b3e839c5a3b2fd5f9d5d2fe55ec799708df9",
                "hex": "41225c89cdd51b25e58574d6270ab2a6d350dfd3a81adecb4bcb26ac1359dd1246ab018ecffe63c18605d8abde2ac85d29c5b6efb0586a9118f179772fcb9078cd4121038b7b11d0adbe61248760d4732cd6b3e839c5a3b2fd5f9d5d2fe55ec799708df9"
            },
            "sequence": 4294967295
        }
    ],
    "vout": [
        {
            "value": 0,
            "n": 0,
            "scriptPubKey": {
                "asm": "OP_RETURN 5920070 71753da172361476d45c003cd70e85d609f33f5806da8f7020721db1b3cf10a5",
                "hex": "6a0446555a002071753da172361476d45c003cd70e85d609f33f5806da8f7020721db1b3cf10a5",
                "type": "nulldata"
            }
        },
        {
            "value": 4879.07,
            "n": 1,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 3d7aef3251348e748a2cc717b7c7fc0ff03fabd7 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a9143d7aef3251348e748a2cc717b7c7fc0ff03fabd788ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qq7h4mej2y6guay29nr30d78ls8lq0at6uupzq08ea"
                ]
            }
        },
        {
            "value": 11223.23,
            "n": 2,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 d75e9ee66820ab398f3f9e46c1ca455fe0f2fce0 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a914d75e9ee66820ab398f3f9e46c1ca455fe0f2fce088ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qrt4a8hxdqs2kwv0870ydsw2g407puhuuq53f7f49m"
                ]
            }
        },
        {
            "value": 12200.08,
            "n": 3,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 013db704b9b14b56586fe1aedc0c6c4cfd91d0f4 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a914013db704b9b14b56586fe1aedc0c6c4cfd91d0f488ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qqqnmdcyhxc5k4jcdls6ahqvd3x0myws7s3yywdc7c"
                ]
            }
        },
        {
            "value": 15905.83,
            "n": 4,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 fb502ea886903825b20e92839d919b548a6f6ac8 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a914fb502ea886903825b20e92839d919b548a6f6ac888ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qra4qt4gs6grsfdjp6fg88v3nd2g5mm2eqksv52s4t"
                ]
            }
        },
        {
            "value": 21918.65,
            "n": 5,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 793bf52d7bde13ba5c1af7f7263af1cfa6df5cff OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a914793bf52d7bde13ba5c1af7f7263af1cfa6df5cff88ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qpunhafd000p8wjurtmlwf367886dh6ulumnwdjpvv"
                ]
            }
        },
        {
            "value": 25636.29,
            "n": 6,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 c499bfa703cef8b33f9b163a195ad49efc7f6c9e OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a914c499bfa703cef8b33f9b163a195ad49efc7f6c9e88ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qrzfn0a8q0803velnvtr5x266j00clmvncys07dgm4"
                ]
            }
        },
        {
            "value": 32904.35,
            "n": 7,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 1cdeb9eb5cd2b81d64b00940e49565e60db7a7ff OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a9141cdeb9eb5cd2b81d64b00940e49565e60db7a7ff88ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qqwdaw0ttnfts8tykqy5pey4vhnqmda8luqn4w8jlr"
                ]
            }
        },
        {
            "value": 39082.83,
            "n": 8,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 e68661e64d235dd54bc102845f411802fcad8f63 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a914e68661e64d235dd54bc102845f411802fcad8f6388ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qrngvc0xf534m42tcypggh6prqp0etv0vvp3xns52r"
                ]
            }
        },
        {
            "value": 46381.95,
            "n": 9,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 f22c4373d9d438f6cb1c0841dc7e6104d11f6c0d OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a914f22c4373d9d438f6cb1c0841dc7e6104d11f6c0d88ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qrezcsmnm82r3aktrsyyrhr7vyzdz8mvp5zjdfc5c0"
                ]
            }
        },
        {
            "value": 47040.22,
            "n": 10,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 ab01a9d202116b2be510abed8c5b14d41749ed0c OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a914ab01a9d202116b2be510abed8c5b14d41749ed0c88ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qz4sr2wjqggkk2l9zz47mrzmzn2pwj0dpsjq5jqlvn"
                ]
            }
        },
        {
            "value": 49118.24,
            "n": 11,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 6911aedf2341d8d4b0d3475eb891ddd94c12b423 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a9146911aedf2341d8d4b0d3475eb891ddd94c12b42388ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qp53rtklydqa349s6dr4awy3mhv5cy45yvzq4hq5lg"
                ]
            }
        },
        {
            "value": 60148.83,
            "n": 12,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 0ce8116b3ab32af1a56c94501585babf6c119072 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a9140ce8116b3ab32af1a56c94501585babf6c11907288ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qqxwsytt82ej4ud9dj29q9v9h2lkcyvswgl9y8k5z5"
                ]
            }
        },
        {
            "value": 62899.43,
            "n": 13,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 37fb35c8a77fb90566f6e7377781f7d965d1a88f OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a91437fb35c8a77fb90566f6e7377781f7d965d1a88f88ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qqmlkdwg5almjptx7mnnwaup7lvkt5dg3un2v8l2ls"
                ]
            }
        },
        {
            "value": 73046.12,
            "n": 14,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 42baeef063cd3abaabdc4e2d0ae434585077e319 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a91442baeef063cd3abaabdc4e2d0ae434585077e31988ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qppt4mhsv0xn4w4tm38z6zhyx3v9qalrry9rm7fgsj"
                ]
            }
        },
        {
            "value": 88233.72,
            "n": 15,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 71d34aca20fc0aaf881385a43607337ead25c971 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a91471d34aca20fc0aaf881385a43607337ead25c97188ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qpcaxjk2yr7q4tugzwz6gds8xdl26fwfwyu3ma96mt"
                ]
            }
        },
        {
            "value": 109635.77,
            "n": 16,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 9406a99a869e6f5a3d8224d5a1a5565e2541869d OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a9149406a99a869e6f5a3d8224d5a1a5565e2541869d88ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qz2qd2v6s60x7k3asgjdtgd92e0z2svxn5k96p9r50"
                ]
            }
        },
        {
            "value": 114148.06,
            "n": 17,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 9cdcaece490604ef70425960fd1965ff86607821 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a9149cdcaece490604ef70425960fd1965ff8660782188ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qzwdetkwfyrqfmmsgfvkplgevhlcvcrcyy9vyzjzn0"
                ]
            }
        },
        {
            "value": 116605.1,
            "n": 18,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 e8a7536b61717c2f076ce3947edb2baf960f4a01 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a914e8a7536b61717c2f076ce3947edb2baf960f4a0188ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qr52w5mtv9chctc8dn3eglkm9whevr62qy9v6ue6em"
                ]
            }
        },
        {
            "value": 116979.28,
            "n": 19,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 c365b305f8cc681282edeb54e8fe7208e8b22b68 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a914c365b305f8cc681282edeb54e8fe7208e8b22b6888ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qrpktvc9lrxxsy5zah44f687wgyw3v3tdq98e9tjp6"
                ]
            }
        },
        {
            "value": 122129.65,
            "n": 20,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 31e9d50d0f7c2b90663358f5faa76b79152b0583 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a91431e9d50d0f7c2b90663358f5faa76b79152b058388ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qqc7n4gdpa7zhyrxxdv0t748ddu322c9sv5gqlczs9"
                ]
            }
        },
        {
            "value": 125442.93,
            "n": 21,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 e5fcd6818189f96ad03c7bcd4525c32fc8d6cc2c OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a914e5fcd6818189f96ad03c7bcd4525c32fc8d6cc2c88ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qrjle45psxylj6ks83au63f9cvhu34kv9s7ska92c0"
                ]
            }
        },
        {
            "value": 132104.85,
            "n": 22,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 348e8ac2041a1cc3f8d130f85b92ba7db77cd906 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a914348e8ac2041a1cc3f8d130f85b92ba7db77cd90688ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qq6gazkzqsdpeslc6yc0skujhf7mwlxeqcnny0ytz6"
                ]
            }
        },
        {
            "value": 133517.91,
            "n": 23,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 4d6098f33d541f9e62f370bf762af7b0c68bc5de OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a9144d6098f33d541f9e62f370bf762af7b0c68bc5de88ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qpxkpx8n842pl8nz7dct7a3277cvdz79mcht3u8tf5"
                ]
            }
        },
        {
            "value": 134294.6,
            "n": 24,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 49b9cdeb8fda45d76f9f1c082ae49b4c8cdc6a6e OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a91449b9cdeb8fda45d76f9f1c082ae49b4c8cdc6a6e88ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qpymnn0t3ldyt4m0nuwqs2hyndxgehr2dcxzhkh9sx"
                ]
            }
        },
        {
            "value": 140342.01,
            "n": 25,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 0d97813d7cb953db557da5f6cb8f5436b07b3b07 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a9140d97813d7cb953db557da5f6cb8f5436b07b3b0788ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qqxe0qfa0ju48k640kjldju02smtq7emquqgrh94at"
                ]
            }
        },
        {
            "value": 140800.28,
            "n": 26,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 61703fc6ea76d653c7284588d880fae3ba93d567 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a91461703fc6ea76d653c7284588d880fae3ba93d56788ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qpshq07xafmdv5789pzc3kyqlt3m4y74vum87ksjt3"
                ]
            }
        },
        {
            "value": 143095.94,
            "n": 27,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 01b977a81329d0e903fa2285fb2d8e317f15cd73 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a91401b977a81329d0e903fa2285fb2d8e317f15cd7388ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qqqmjaagzv5ap6grlg3gt7ed3cch79wdwvu65myj2u"
                ]
            }
        },
        {
            "value": 144768.76,
            "n": 28,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 d0b108fb36803d366e8ee76f58415781d8f68dc0 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a914d0b108fb36803d366e8ee76f58415781d8f68dc088ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qrgtzz8mx6qr6dnw3mnk7kzp27qa3a5dcqggna0wp4"
                ]
            }
        },
        {
            "value": 145390.69,
            "n": 29,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 dac9d86036d50fc50e14cff0fa57d03844396ca8 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a914dac9d86036d50fc50e14cff0fa57d03844396ca888ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qrdvnkrqxm2sl3gwzn8lp7jh6quygwtv4qq4wjyaae"
                ]
            }
        },
        {
            "value": 151452.4,
            "n": 30,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 23577d96d644426b18488f20cc67c9cb8f532183 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a91423577d96d644426b18488f20cc67c9cb8f53218388ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qq34wlvk6ezyy6ccfz8jpnr8e89c75epsvxm26vjty"
                ]
            }
        },
        {
            "value": 167356.03,
            "n": 31,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 5350f9f5c8462f64d296b7bb1abcd492693986d0 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a9145350f9f5c8462f64d296b7bb1abcd492693986d088ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qpf4p704eprz7exjj6mmkx4u6jfxjwvx6quaftd486"
                ]
            }
        },
        {
            "value": 167604.3,
            "n": 32,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 8e6ff7fb9017270498942a6d71a8f92dbbedbfd6 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a9148e6ff7fb9017270498942a6d71a8f92dbbedbfd688ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qz8xlalmjqtjwpycjs4x6udglykmhmdl6cejsn8vg2"
                ]
            }
        },
        {
            "value": 168426.28,
            "n": 33,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 d1990b3025dd770304dd2619b150130cccc97445 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a914d1990b3025dd770304dd2619b150130cccc9744588ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qrgejzesyhwhwqcym5npnv2szvxvejt5g5es5yj0vk"
                ]
            }
        },
        {
            "value": 169530.54,
            "n": 34,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 2e06e470c2fad340434bfc43fa0002fd2fb54c7e OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a9142e06e470c2fad340434bfc43fa0002fd2fb54c7e88ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qqhqdersctadxszrf07y87sqqt7jld2v0cwv58h8sm"
                ]
            }
        },
        {
            "value": 176922.16,
            "n": 35,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 217c701662e9c313352e8617f4adca4454f2da3e OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a914217c701662e9c313352e8617f4adca4454f2da3e88ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qqshcuqkvt5uxye496rp0a9defz9fuk68cpkz7uvdq"
                ]
            }
        },
        {
            "value": 193075.21,
            "n": 36,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 32a5c928c805e9663330df4d7b8480bf957cb8bc OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a91432a5c928c805e9663330df4d7b8480bf957cb8bc88ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qqe2tjfgeqz7je3nxr0567uyszle2l9chsyp5jv4ad"
                ]
            }
        },
        {
            "value": 200659.81,
            "n": 37,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 f6c71b990456ff124d4eb9f6fefdc5e6fc5a9e6e OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a914f6c71b990456ff124d4eb9f6fefdc5e6fc5a9e6e88ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qrmvwxueq3t07yjdf6uldlhachn0ck57dc9hqe5tms"
                ]
            }
        },
        {
            "value": 204020.59,
            "n": 38,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 3f6587e7ae507f70f7960e75566fef89adcb1202 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a9143f6587e7ae507f70f7960e75566fef89adcb120288ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qqlktpl84eg87u8hjc8824n0a7y6mjcjqgfka0zw4t"
                ]
            }
        },
        {
            "value": 235409.79,
            "n": 39,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 f1195d9598cdc85964ff4e6ce058a96f40977429 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a914f1195d9598cdc85964ff4e6ce058a96f4097742988ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qrc3jhv4nrxusktyla8xeczc49h5p9m59yx8hl4we4"
                ]
            }
        },
        {
            "value": 299745.73,
            "n": 40,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 cdd3995e980e4576a91b85bc23eca725dfc18601 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a914cdd3995e980e4576a91b85bc23eca725dfc1860188ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qrxa8x27nq8y2a4frwzmcglv5ujalsvxqykrhemtp0"
                ]
            }
        },
        {
            "value": 302754.47,
            "n": 41,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 079cc4c0cdddf4c6f338385907e530c57b82af73 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a914079cc4c0cdddf4c6f338385907e530c57b82af7388ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qqree3xqehwlf3hn8qu9jpl9xrzhhq40wv4qj85443"
                ]
            }
        },
        {
            "value": 304028.43,
            "n": 42,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 33d7bdf0b0df0109f2ae0ba7e582dce94c26d0ba OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a91433d7bdf0b0df0109f2ae0ba7e582dce94c26d0ba88ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qqea000skr0szz0j4c960evzmn55cfkshgveqt2sw7"
                ]
            }
        },
        {
            "value": 402993.38,
            "n": 43,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 0efe43d45455d6c315d6d06913d8dfe35993c778 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a9140efe43d45455d6c315d6d06913d8dfe35993c77888ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qq80us75232adsc46mgxjy7cml34ny780qnk03arjn"
                ]
            }
        },
        {
            "value": 404787.27,
            "n": 44,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 54c58c76ad467dd374ca28ebb6d2963a5e11e89a OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a91454c58c76ad467dd374ca28ebb6d2963a5e11e89a88ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qp2vtrrk44r8m5m5eg5whdkjjca9uy0gngnqf97t3k"
                ]
            }
        },
        {
            "value": 472993.06,
            "n": 45,
            "scriptPubKey": {
                "asm": "OP_DUP OP_HASH160 9ebef47b17517acb6574483a411fb69149151d83 OP_EQUALVERIFY OP_CHECKSIG",
                "hex": "76a9149ebef47b17517acb6574483a411fb69149151d8388ac",
                "reqSigs": 1,
                "type": "pubkeyhash",
                "addresses": [
                    "ecash:qz0taarmzagh4jm9w3yr5sglk6g5j9gasvlg53tgtz"
                ]
            }
        }
    ],
    "hex": "010000002e42b9c785e9d86cb2da01c145fbb32eac550ba1d37f5fea75a8cdfdc90288fc1709000000644119c3e1ea9ed7e4f8d760082da1c2d83d03ad16cb60dac333a3e7c5f561a1276a83822d5ebea8cd31bedce7818b2f8845df82d080884aa2c0e2ecbf8b4d2e9c33412102105792f01a0493cd19698509ba57be9e15881af9957102c1c06b6a582abe8c79ffffffff3da3ab5c088a829a6e67638334b77a17733e4b2917ce584d0cafc9616e7628222c00000064410013f00452453341f3911299002fc8362915cb8df3fed4279942685d2fb0cf9606e3e1aa5000c285de7f824844fa58ca9d746308701533d3eecbab4f53b6b137412103a6a4f9bf118a74990dc56ff214a23244abcd7215f162260a07e116f36465f868fffffffffbed34fddb81e9673ea8795f8e5ff5e2c443567080eb8f5239229fe7cd219e221d0000006441e986a00851238d48c6ecaebdcaddfafffe088f075259012117c272bb73e64cd01e9a707ffcb017d468edcebc265f9f3978195a5cd5cbe5ede38e3ce0cfcf409e4121032e0c9bf69404e033e171e75d850176b3256348a0c9a9e45cf286962bd43d48aefffffffffbed34fddb81e9673ea8795f8e5ff5e2c443567080eb8f5239229fe7cd219e22200000006441838d0591451879a008f5c70970d600504251173681e09bc1012400cd3a4496a550f22cf5d60fc49be921efd27851a37bac6d2ecc2e8c7826108bf94673c769b8412102c72fbb98ef796270d44a971f15efeab25369e22c77b72ca5dd9fb1e0ad4f04f4fffffffffbed34fddb81e9673ea8795f8e5ff5e2c443567080eb8f5239229fe7cd219e222c000000644161ecddaee7ae9e9e8ae9a5e0536ddf5cb3dd68b0244dd9effd353eeb8afcd41d7217ff49ac96c80c1e09c3fa05e7d8c5c98f210ab2c8f3c339b7a7000c64f2ca412103750674c62f32f6e15587d48c3b86ea18ce07abb477dcbf01adf1090548fc8c99fffffffffbed34fddb81e9673ea8795f8e5ff5e2c443567080eb8f5239229fe7cd219e222e00000064412db03e2bc220a2c120ddd699887d5a4e7eabb31141271dca9e5548a3ca10656ad15b582a6f49c9fea37fdc973920868fb25357bfff8826a606e23a57d165185b41210255be8270cd432b9419db34577ed1ce5841f229c41148f3457b3095f7bd33f095fffffffffbed34fddb81e9673ea8795f8e5ff5e2c443567080eb8f5239229fe7cd219e223500000064419f949837d3c6334d11d9c446c3daa5e2101a416aca93d35a602894d553ba0d61d90bfc4cad764e2369d9c25cd41a352ebe36bb7e9dd5a29ade784c58e88a3482412103168a81409d3eb5851f30cd3f01da1cfb3779a239d3b2d20e99029a38d4e20094ffffffff61fea10597a9300b5a1368e61e12604f20002cee6489d7c4bcb557fb68bb93420900000064415d84e68a797b70b602c914af24f3baaa4edb6cf0aceedbdb7b0ee5a0c9a30217695147749c342afb4088519a19a34e36bfd101cb4e5f0bf980f9db5aeb1fae3841210386caf234ef321cd0e8f338115cf48681f8acd02bc44699744ba0143574c3a479ffffffff1396f7df0d3c9fc8a43a3d4481541bbb94b80b17fd6da11fd1ed92c899533e5e0c0000006441c69af4483857bbf1edad0af60f60d7efd6f5bdfa50f242022dae2bfdc5a620590e8e436b12ed96c8025c48c3744b1a621f5aa9265864e5eb9a5ecaec742cdcc34121030a0cb5603fed0ef228876f13090e88b9b1e2847e7dccfd4dd52ac14870f59834ffffffff1427036d6b3522988535173b95b51db5ee2092dd449e24f1bf4b80d2e90dc9631e000000644192ae497fdbc60112ca96790856214ea7a69dfe6825f3f5f990f92060acf367ee9cb59eed93b8249ebfd2161d1fa4fc2ad19d5e5fa2589198a73833dfed9bcb9341210247acdbfdda61241f4451729e8f04465657273f80a1919e58474d5e5b9c356e76ffffffff7ac7cfe8e2ce3a000145b2d8813e9fd0fcc9a9f9a39047fb39e6467a6970d9732e0000006441e389da2b9ecbe9044dbb6872a72492a919681e4eb1898b30e87d432ad2606398e0de06c4638578678acb4815847c1e966a8486125f0b6ecd738b92cd1dadb1fe412103b59be878fd25b40719d79290fbf916edb2c1c1b16156a43dbd5f577687053facffffffff5d8526ac06bc078bbaf5c714072c74be0d8943f9230cbdc2cf07938e045e467808000000644153fa14581c6c5f26289efc2e3532bcf1114287bb8965655ffd283b6f88c22fad8fe2ee2a343c3596dd8309862f853198f6dd4326558a0d9fa81287fb3dc586e3412103cac0e28f52bd194c73004b2ba298638a6aa374c88fe1a25afe7921410c811967ffffffff5d8526ac06bc078bbaf5c714072c74be0d8943f9230cbdc2cf07938e045e4678110000006441e2e27648342f377307c64b6aafa399ff6254e78afccbadda4acb5c93c56b64a3a4326241305c688385bc4ead7e56432f220f7a741e95318439333ac247d34e7e41210237f26bc7d47d64eaae12adf28385440c71846933bdf6d2f2eea778521ba68531ffffffff70a888f2cd8e11c45109be4a0627d7478be6abd0f7d5f701b37dd15abbcc3c800800000064411f127bf5c1621c847f1035c7ab0b974fb012a53a4d74af2ebf234b9dca8d0627314bd1380a23f988a1eb924b7e8d835b18010d66d4879066ec86fdf0ac4643354121030aacbacf8a4e54e50c15e90fd9fa70bbbd5125de094fc8971cf45ea1f7c8080effffffff70a888f2cd8e11c45109be4a0627d7478be6abd0f7d5f701b37dd15abbcc3c80090000006441b515c4c29a05cfb202beb1d7cdf46afa5b83e16b68210a418edb8dc9b78a6668da02361e6086d2f247855cbed7fe5675409dad2bdfe892a5636b16b6194c47ea41210281f102a57397b784c3df2c12c282bafa09a771bcb9fa0c97d5eddf3d80bdc8abffffffff70a888f2cd8e11c45109be4a0627d7478be6abd0f7d5f701b37dd15abbcc3c800b0000006441bcdb38f9b1363ece1b6471807b1b5bb379b0515afdd1fdc05a91b02145811cf88b6045a377eaff1d4a0a4b78c17922795beebb8bd9f76e8a958a677fd5d562ba4121030dcc81b66e218c3455bb21f6861dc861e577f1603830d97d72d34e72b9ac6968ffffffff70a888f2cd8e11c45109be4a0627d7478be6abd0f7d5f701b37dd15abbcc3c800f00000064416f683ef158e38c701934638eda0728be44c4e6ce2e27f446bbc8b7ca2a790a9dbb4bacd08209de0db1f77f2c2b80f7309bcb8537285e7b1501339384fdb9a266412103f3fa4089d439011523fc2d566d13f1b523e53ecc30599d7a6c649fd082ae8f79ffffffff70a888f2cd8e11c45109be4a0627d7478be6abd0f7d5f701b37dd15abbcc3c801c00000064410c4406667f99a3a24e094d036babd4dcf27a4988b906b4952b364816e246d6495a0f6dafbd94fe2efcd3a4433c941b4e3e862637a39875b596fa7a488c7a2143412102ef7adb0b4a83a5f8325505e61f17eb7e4d71bdd777f1e131cec421e6ca65b22fffffffffb8bf26f1a9f54fab343d37d2722048a8873bab292818f65cc021c9ce98e08e87070000006441e6c6d783b5073c0742ff54132c5b1b0766e1d23a5322ef1bf1f6ce464c4c8a6bcdf6876e86c4a412518119a1381eb6622f3f273be7a9274b3b75ade89c1ddc02412103ad0ab9ef0608bc3a7a425875700e1ef5141e293ab3c62a9f38520936dddafc12ffffffff187aa01aa78305b71223a9ce785d39e7076386487360c6959c6d18f624ac8b9e04000000644185740696857ec49e6cfdb0356ae4347c6c45c2ff2e7c7c54a95393b208d2da83a4dbe69b9a12eef9aa53afc1db223ca3b2a49490b0f4031537a00e225cabdd3e412102c28801a5f2e231087dba3aedab1d6c440e0f98c3fa38ca4a00c0100c62ddc0ffffffffffaa4bd5168528386b151b97fa425c7796ce5d3271ec4f09aee0de0bfe3db70da52700000064416c2f5320111a1122efc643dfb2f6342d44334cd4bfe24afcde10cdfa72077f00bca0e894d7bdd317900aa0a43603227856e0d5f99b7cfe99c109407f7d6656504121036fd2304b7eabb4675ad63ee6f3fa81c87f8faf37bf18dc2906f47333a4a03dabffffffffaa4bd5168528386b151b97fa425c7796ce5d3271ec4f09aee0de0bfe3db70da52d00000064411db90a12d709a501212172caf671539c12ab88935ba851cfabc81e5cef9aab15b9b31234b2853ac545df4bd5d55499e77c108b302bc850b67d5eb952d4b02cc041210394e2d7151be508e3ae3735e42be829645d76585756b75f54fbd1a8a8e8dc835dffffffffaa4bd5168528386b151b97fa425c7796ce5d3271ec4f09aee0de0bfe3db70da533000000644150343bf802315b3d83adef4031313fb3e5379bbefa9ff2c36b983918e2c09841f4c04e234a597dc838847d9c488676a8a46c0eda9e369524c171be8381d711ca4121021eead4e66e4601c68ccda0ddddddf464d695e115861ce9679779f6cbc6f11388ffffffff25d9046eea3b3bb98665415d5e69df23e6a4a9d7c1e54891d1406aec3f3174b70e0000006441684b57cbba0f68036262d1ac065c5992bad5abf6072e4297b1a7765f693bb4ebea1eaa8eefeefc1114b4206e155fe3792d3b2e88a1535a7d682eefdd4ae262af4121024809c959c890757968daee0e5a01ea357defdf8219eab90fc2ca51eee8178380ffffffff25d9046eea3b3bb98665415d5e69df23e6a4a9d7c1e54891d1406aec3f3174b7280000006441c684f9554dede4ada5004659b90df87a0f9bf3f254c329efb2bc7f2ffdf25b042821d476baa3b1d5f558b5eb04c0ececc59d51bd4b5fef30f9e7ed5550ca84724121032043dad8f4aa7eb5e87b42d662549e7a985f945e566ed7d06da58a790e2ed968ffffffff25d9046eea3b3bb98665415d5e69df23e6a4a9d7c1e54891d1406aec3f3174b751000000644195ef6f13a456aeb1d09c3a4f25334619dbfa721eea43fd541fff13197c1f21df6cf6e798b8448f6dd96c8cbff601ec1d6745a31cf1ab3b24ba720fe0bc32d9ce412102b4bc1b339abaa6575e5dcd58a24be28d75d9d9b9ee89db46b363ae99d62ac8a6ffffffffb1bdc586694b5de4a48fa26d8859bf9fa8e15f9424c9a7750af665b5558e41ba0f0000006441463c5d017801dab770d63a42ac138524513903a5240c0668ed63b806927657d522101dba912c9e364623eeaf8e8a868b4c495b9eb1d263d7ff444b90864bd7c9412103eb30c0cdf651a033a647e86dbad331be7320eef8aa2da0c908fa1983ced8c6e2ffffffffb1bdc586694b5de4a48fa26d8859bf9fa8e15f9424c9a7750af665b5558e41ba16000000644112209ca22b888a4e6da118031578c4623ec88d7e94cc5e3d87c3f5613b524606760ba3a6b9e79450b519072a4a4e90bae94b48d58c4c693ae0097d9508130018412103311a9459a479923e51e4e2774405a2af01a1793bb663f2864cbf8233ee97eeecfffffffffb334b0c1106ace4a2f30dd9a6f00180e81bec0ee0f1abadca430b28d83396ba1800000064415e562d61d13a70c288c07de9e05554c183ef5be99b26fc13e6afcf86def6290cdcad7590aaef3efdd018a558420257e0e889867a10de4589559e3ba8ad7b91c0412102173612cd9fd086509df83a4f888b700aa058756d9cc8c74993c901b4adbc675ffffffffffb334b0c1106ace4a2f30dd9a6f00180e81bec0ee0f1abadca430b28d83396ba280000006441836f7ff51456eb33a265f4e588909ab2143c99ef9ca5133131783571bc7008d73db97f947d294f60d68a8d1ad8e59c5cb27895d5de5ae982dcdf151e8635191e412103f3142df0e6a05a2db0991e65ea017079cfb0382a9394ed5fc11568c98bc67066ffffffff3a9627d06eb3c67c3a7fa1679a7d5a3b4589d13dbba4f6fadf09dbd32285f8bd2c000000644175e62e31a83fdde2cfa04c5ec14ce73209939f6b683ebbab24713f9391b279960b511d0be24f7f59dba5eb6f1f28331175419bd0836f180eec8c39e3ed60ccc8412102f2de07ea4d810f26e44f9916527c2e2d6788672cf7fb6e8e7db713752e53923bffffffff3a9627d06eb3c67c3a7fa1679a7d5a3b4589d13dbba4f6fadf09dbd32285f8bd5d00000064419459e9caa64eed155109b86bd6fa7c681d056647e2b3a611a1d1104486643a237cd4b833ba92eba9135080107271fdaf1a03accee1f049378ccea91109a5565f412103dd4e1933febabf22b085dea3d5ae87f9c68a50282ab03b893e7b2d3e48117783ffffffff3a9627d06eb3c67c3a7fa1679a7d5a3b4589d13dbba4f6fadf09dbd32285f8bd6000000064413feed27a60e6790b0b950b1e20839f87ccf21af644074c7548d7490238963d4606fa588802f280d1a0ee1e665f74454810fa04a758e0adb4ad2566d0376b48df412103d30e63a51dd5b0fafd6ec8025189c3cf47e35b08f47e64011e5c6d3c5df9d559ffffffff7d53f1b3cadc0e40e08f8d534c9ec3edca0bf6e6f6f10b8ffc3beacdeafd8bbf01000000644164be71292ddfd6e9746dc08850766e91bb1cb5cef0ca0ea4db1478035a94ca84b7ad3a7a104a73560cb8a9f386d0dc9e19fe0fbecc272d96020707b01851aa444121020b98a876ce418d27208fd0693e3855fd583574ec719cc93248137b4af26fdbcdfffffffff9a46e49bdc36a13674259504345c6a3ffa80508cf94caf313420a1ccdef0ccf0a0000006441fb5fb146938897a3d52e8a3042e1d198c4d9f8a7ecbdf38b5c0e152bb94558e024bb5493313cf66aba70231323cb83de9312cbac78dc76aa26eb5425296233c3412102034616155fcd1e1bed39b790a75bd3257435511d047276008c9f6dc1923c7a69fffffffff9a46e49bdc36a13674259504345c6a3ffa80508cf94caf313420a1ccdef0ccf0b000000644169ea493fb3a8a152a9dc40b0b12975f7b4ec1599238c8c6a448be5da23eceb8f6e8f813d126b2a0ac9b0c4d8e42b137222ff95907d68381a8d6e1eb737da2cde4121032ec5bc4dc5b2fe7255f36fef71bd922b1812084119fbd9c52a92756fc3e9ec4efffffffff9a46e49bdc36a13674259504345c6a3ffa80508cf94caf313420a1ccdef0ccf1400000064419c3a911e18e32b2e1613b9e3dea692025827a5d9f48a4b02d6c04ae419e78bc2c530f11d9180f8510a2ff1c33a8616d860d30eb05587469db3bbbc4612b829de4121031f6d95094c335fdcf558fd92a27c95d498f0f5e4752b48b1207b36f7dffc44bcffffffff65106543adae3ad50ff7a7f7ce0bcece97811fda2069deb08fa9605862935bd95100000064415b1a732d13ad47469ddc736365c9626df6d3172310e5b0f615e7c9b49aa1a557b8420969debb1eac48430be280c3554bc3465a6836b5ac07e13c7f8200e1764e4121022909c62b2800fbf38bbba317d69595ca43d178592c5e066fdd6ad46d390128fbffffffff5c75b1523d64d3983c1cc865f780c51a55a09c8e25189b1032caa590e3715ada2e0000006441af68ac31028479b21f5ae91fa3d22d094c86baadc3fffc2f0968c12ad5e72b881934d12f395c6dc5819cd7a3c8d987228602ea42f9810f540b40a7dd4a53af67412102561b36b5462c0d7ba632f777ae0aacb29d3a5e6bdc6120d9431f18e66f3f587dffffffff858b04b19dfd9362fea411238a37cffc561b9df83a9d59562e3f7c40887caedb0d0000006441ef7d89adabf992582e3cedac30fe3cbc8de46e7e54958dc5411b211f2bab41db55808c8097e5187c3f4b0fe06d7a4c56978b7d934c0dc5deeba99bc56db76f3a4121036f32cfef910220b4fa0d5378065a4f8d57715cbfbef8acd36422e40d992dc03bffffffff42d6eeb60459540c73a11905363c58851ce5486aee6588d186e8a42f31cffae70e0000006441c21e72b9f34bc18e849c2660c0b130f71270c1fffa017556e45fc8dd5ad02bb1fded528ec7c4c6bdfc351089a984cfeb6a43ceead5c0b6e28d5a3f9ea21d547e41210304884cdaa6ca2375866f65402b397984f88583025042cd4c57f870595c421d18ffffffff42d6eeb60459540c73a11905363c58851ce5486aee6588d186e8a42f31cffae7130000006441b72bc232aecab332c45667d5663ef37f86025a074461687b135e3ec272c41d3539cf4228f89794a937e5a12cd32bcff08251d3a55401fa9ac6921a41f20a116c412103946e8a3b71b6886df066589596ab6cfb8f5995c2a635b88ecce52211c139ab84ffffffff42d6eeb60459540c73a11905363c58851ce5486aee6588d186e8a42f31cffae71c00000064417ca2ba78e7dc92ed39a42ebfaf49a6455c07c8c8a2364bbfdddb7a5cf99ae35bd5fab4acc3abc8a2fdd6b4d23896f855cdc85b464ae85f4688b357b251e1517d4121021056618df94fbe9c9a327758ffe35fbf3684ae9d5b5c47f61592d07fce8c0dd6ffffffff08acf246d564720ba74996ed9abef1e46ed071a906f55bcf29066089cc9f56ef200000006441e73f3d61b99d45a9429be0bdbbcb2bda77384c6feb37a6a3de0329a7cc03cccbed08930769f6ed51ed68f52ac2ef9ed10409b267425d797f40afcf699effd48e412103bfe0cbc3b88241f098c4824c995873f0b9ad25099f16de9286dafb3533faea88ffffffffa1249785e510e4e3428875d2db48125862d6cba214a64f800a0c67fa7a03f1f40200000064410c9af0e0795b433b8ae41ed9aa386a95ef7600b73c7a86c86036bc6c19bed600c8ade6533e81fc4f0720c117225c49497518b346475b8d980f1492937eff73ca41210293a07ccb936c98578d5149fc611d688d6baecac80c44b4677411a852572fd160ffffffffa1249785e510e4e3428875d2db48125862d6cba214a64f800a0c67fa7a03f1f4410000006441225c89cdd51b25e58574d6270ab2a6d350dfd3a81adecb4bcb26ac1359dd1246ab018ecffe63c18605d8abde2ac85d29c5b6efb0586a9118f179772fcb9078cd4121038b7b11d0adbe61248760d4732cd6b3e839c5a3b2fd5f9d5d2fe55ec799708df9ffffffff2e0000000000000000276a0446555a002071753da172361476d45c003cd70e85d609f33f5806da8f7020721db1b3cf10a5e3710700000000001976a9143d7aef3251348e748a2cc717b7c7fc0ff03fabd788ac13201100000000001976a914d75e9ee66820ab398f3f9e46c1ca455fe0f2fce088aca89d1200000000001976a914013db704b9b14b56586fe1aedc0c6c4cfd91d0f488ac37451800000000001976a914fb502ea886903825b20e92839d919b548a6f6ac888acf9712100000000001976a914793bf52d7bde13ba5c1af7f7263af1cfa6df5cff88ac2d1e2700000000001976a914c499bfa703cef8b33f9b163a195ad49efc7f6c9e88ac43353200000000001976a9141cdeb9eb5cd2b81d64b00940e49565e60db7a7ff88acbba23b00000000001976a914e68661e64d235dd54bc102845f411802fcad8f6388acf3c54600000000001976a914f22c4373d9d438f6cb1c0841dc7e6104d11f6c0d88ac16c74700000000001976a914ab01a9d202116b2be510abed8c5b14d41749ed0c88acd0f24a00000000001976a9146911aedf2341d8d4b0d3475eb891ddd94c12b42388aca3c75b00000000001976a9140ce8116b3ab32af1a56c94501585babf6c11907288ac17fa5f00000000001976a91437fb35c8a77fb90566f6e7377781f7d965d1a88f88aca4756f00000000001976a91442baeef063cd3abaabdc4e2d0ae434585077e31988ac4ca28600000000001976a91471d34aca20fc0aaf881385a43607337ead25c97188ac794aa700000000001976a9149406a99a869e6f5a3d8224d5a1a5565e2541869d88ac162dae00000000001976a9149cdcaece490604ef70425960fd1965ff8660782188acdeecb100000000001976a914e8a7536b61717c2f076ce3947edb2baf960f4a0188ac087fb200000000001976a914c365b305f8cc681282edeb54e8fe7208e8b22b6888ace55aba00000000001976a91431e9d50d0f7c2b90663358f5faa76b79152b058388ac2569bf00000000001976a914e5fcd6818189f96ad03c7bcd4525c32fc8d6cc2c88ac7593c900000000001976a914348e8ac2041a1cc3f8d130f85b92ba7db77cd90688ac6fbbcb00000000001976a9144d6098f33d541f9e62f370bf762af7b0c68bc5de88acd4eacc00000000001976a91449b9cdeb8fda45d76f9f1c082ae49b4c8cdc6a6e88ac1925d600000000001976a9140d97813d7cb953db557da5f6cb8f5436b07b3b0788ac1cd8d600000000001976a91461703fc6ea76d653c7284588d880fae3ba93d56788acda58da00000000001976a91401b977a81329d0e903fa2285fb2d8e317f15cd7388ac4ce6dc00000000001976a914d0b108fb36803d366e8ee76f58415781d8f68dc088ac3dd9dd00000000001976a914dac9d86036d50fc50e14cff0fa57d03844396ca888ac1819e700000000001976a91423577d96d644426b18488f20cc67c9cb8f53218388ac735dff00000000001976a9145350f9f5c8462f64d296b7bb1abcd492693986d088ac6ebeff00000000001976a9148e6ff7fb9017270498942a6d71a8f92dbbedbfd688ac84ff0001000000001976a914d1990b3025dd770304dd2619b150130cccc9744588acdeae0201000000001976a9142e06e470c2fad340434bfc43fa0002fd2fb54c7e88ac38f60d01000000001976a914217c701662e9c313352e8617f4adca4454f2da3e88ac019c2601000000001976a91432a5c928c805e9663330df4d7b8480bf957cb8bc88acbd2e3201000000001976a914f6c71b990456ff124d4eb9f6fefdc5e6fc5a9e6e88ac8b4f3701000000001976a9143f6587e7ae507f70f7960e75566fef89adcb120288acf3346701000000001976a914f1195d9598cdc85964ff4e6ce058a96f4097742988ac2d60c901000000001976a914cdd3995e980e4576a91b85bc23eca725dfc1860188ac77f7cd01000000001976a914079cc4c0cdddf4c6f338385907e530c57b82af7388ac1be9cf01000000001976a91433d7bdf0b0df0109f2ae0ba7e582dce94c26d0ba88ac4aeb6602000000001976a9140efe43d45455d6c315d6d06913d8dfe35993c77888ac07a86902000000001976a91454c58c76ad467dd374ca28ebb6d2963a5e11e89a88aceabad102000000001976a9149ebef47b17517acb6574483a411fb69149151d8388ac00000000",
    "blockhash": "000000000000000001e433ee4044480c38aa6e2d1e60aa3c297811d65b8529ae",
    "confirmations": 80776,
    "time": 1593495955,
    "blocktime": 1593495955
}

UTXOs


[
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null,
    null
]